CAZyme Information: FOC1_g10001981-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOC1_g10001981-t38_1-p1
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
931	KB729952|CGC1	104312.29	5.9302

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporumrace1	15626	1229664	188	15438

• Gene Location: location=KB729952:33383-36662(-)

Full Sequence      

MRLLGDWFNVIHPLAPILLRRRFLQRLQQGVADVDAEFCGLVISVCAATKATLPRGDYGP
VTVDYCVDFLDAHGLLKSQFTRDSFSMDRCIALYNIGTAMSATTKSGLSSMRAYHALSEA
AAGARYLAYYRIHEHDEAEQQLLRRLIWLLFASACSADIFGRLPISLLSQDRIENFPRPL
PLSDNQMEPGAPDSCHEPPWHGDDTTYVPGLNSLSDLFLIWQEVQQVPDGTEPQTIITRY
LGKIQRVLDNLPPELRWRGGLSRPAHVTEGHDVQIANLFVTSLNIRSNILQKFGPTDKSA
LEHQKIVDDLLEILYHLPRAVFDANGSSLVPKIRDIGAAYLEQTQLGNGVGEVEIGDARI
KLERLLRKLDDLDCWQGIGVLDTPPLRVETLGTPWSILPKLRRPLPRNRECYNYSPRFAP
AQHAHPHLRRSDKGSVQLIVKGKPFLMLPGELHNSSLSSAKFMSEVWPKMKSDHINTLLG
SVTWEMIEPKEGHFDFSELDLVLQGAREHDMHLVLLWFGTYKNADSRAFAALLRHLAEVD
SQHQTVLMVQVQNETGVLGDSRDRSHRANKAFAEPIPSDLLQYLSRVDTHSRFKKRISSV
PSSGNHSWESLFGPGTAADEAFMAHLISSYVGRVAAAGKAEYPIPLYTNTWLNIEGQSEL
DFGGGAPVVVGGGDKPGIYPSGGPCPHVLDIWRFNTPSLDLLAPDLYFHDYETVCRNYTE
QGNTLFIPEQRRDEYGARRIWLSYATYGALGASPFGIDTGSDVIGREFKLLNQTKQYFLD
AAPEDRFGFFFDEEPSEKKPEQWTRTFGDIKVIVERCFVFGKPGPGAGMIIHLGNSKFLL
VGRGFHARFKEARKDATFGGILWGEEKEVDENGNLQTLRILNGDETRHGEFMMMPNDDPD
YGGFPIAVTPGARTCIAEVEAYWIAEDEDDR

Enzyme Prediction     

No EC number prediction in FOC1_g10001981-t38_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407954	DUF5597	2.25e-34	764	893	1	130	Domain of unknown function (DUF5597). This is the C-terminal domain of xyloglucan utilization locus (XyGUL) present in Cellvibrio japonicas. XyGUL is required for xyloglucan utilization. It is also the C-terminal domain of PF02449 and PF01301.
396048	Glyco_hydro_35	1.61e-07	437	563	1	158	Glycosyl hydrolases family 35.
213391	fungal_TF_MHR	2.00e-07	1	316	7	321	fungal transcription factor regulatory middle homology region. This domain is present in the large family of fungal zinc cluster transcription factors that contain an N-terminal GAL4-like C6 zinc binuclear cluster DNA-binding domain. Examples of members of this large fungal group are the following Saccharomyces cerevisiae transcription factors, GAL4, STB5, DAL81, CAT8, RDR1, HAL9, PUT3, PPR1, ASG1, RSF2, PIP2, as well as the C-terminal domain of the Cep3, a subunit of the yeast centromere-binding factor 3. It has been suggested that this region plays a regulatory role.
396834	Glyco_hydro_42	4.08e-07	465	572	10	154	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
224786	GanA	9.10e-06	437	503	7	73	Beta-galactosidase GanA [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKD55254.1|GH35	0.0	419	914	9	548
CEI70370.1|GH35	0.0	424	931	8	559
QPC62716.1|GH35	0.0	425	931	9	559
QPC80089.1|GH35	0.0	425	931	9	559
CZS85660.1|GH35	0.0	425	931	9	559

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7KMN_A	4.40e-63	431	889	31	516	Chain A, Beta-galactosidase, GH35 family [Xanthomonas citri pv. citri str. 306],7KMO_A Chain A, Beta-galactosidase, GH35 [Xanthomonas citri pv. citri str. 306]
3U7V_A	9.06e-60	421	889	35	535	The structure of a putative Beta-galactosidase from Caulobacter crescentus CB15. [Caulobacter vibrioides NA1000]
4D1I_A	9.75e-55	431	889	9	520	The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_B The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_C The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_D The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_E The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_F The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_G The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1I_H The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicus [Cellvibrio japonicus Ueda107],4D1J_A The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_B The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_C The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_D The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_E The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_F The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_G The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107],4D1J_H The structure of the GH35 beta-galactosidase Bgl35A from Cellvibrio japonicas in complex with 1-Deoxygalactonojirimycin [Cellvibrio japonicus Ueda107]
5JAW_A	1.19e-54	431	889	19	530	Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_B Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_C Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_D Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_E Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_F Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_G Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],5JAW_H Structure of a beta galactosidase with inhibitor [Cellvibrio japonicus Ueda107],6TBF_A Chain A, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_B Chain B, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_C Chain C, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_D Chain D, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_E Chain E, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_F Chain F, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_G Chain G, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBF_H Chain H, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_A Chain A, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_B Chain B, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_C Chain C, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_D Chain D, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_E Chain E, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_F Chain F, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_G Chain G, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBG_H Chain H, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_A Chain A, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_B Chain B, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_C Chain C, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_D Chain D, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_E Chain E, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_F Chain F, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_G Chain G, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBH_H Chain H, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBI_A Chain A, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_B Chain B, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_C Chain C, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_D Chain D, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_E Chain E, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_F Chain F, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_G Chain G, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBI_H Chain H, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus],6TBJ_A Chain A, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_B Chain B, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_C Chain C, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_D Chain D, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_E Chain E, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_F Chain F, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_G Chain G, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBJ_H Chain H, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_A Chain A, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_B Chain B, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_C Chain C, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_D Chain D, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_E Chain E, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_F Chain F, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_G Chain G, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107],6TBK_H Chain H, Beta-galactosidase, putative, bgl35A [Cellvibrio japonicus Ueda107]

Swiss-Prot Hits     

FOC1_g10001981-t38_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000014

TMHMM  Annotations     

There is no transmembrane helices in FOC1_g10001981-t38_1-p1.