CAZyme Information: FOC1_g10001941-t38_1-p1

Basic Information

• Species: Fusarium oxysporum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium oxysporum
• CAZyme ID: FOC1_g10001941-t38_1-p1
• CAZy Family: AA7
• CAZyme Description: N-sulfoglucosamine sulfohydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
859		96022.85	6.1531

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Foxysporumrace1	15626	1229664	188	15438

• Gene Location: location=KB730428:74790-78255(+)

Full Sequence      

MSPSKNILLMIADDLGREQVGCYGGESRITPNLDGLAASGSRFDMAFTRTASCSGSRTVI
YTGLHTHETGSYGLTHGNNGFRTFDNVESAPLLFKNIGYKTGILGKIADEADAFFQLSKA
EDNPFFFTIGFVDPHRQLGTQGGFGNVQDNYDPRLNDKIFKPEDVTVPSFLSDIPEVREE
FAEYYRSIHQMDQGVGMVLRALERNGLADDTLVLFLSDNGPPFVNSKTTLFEAGVRLPFL
MRAPGFIIPGNANPNLVSYVDILPTFLDWAGHSNMPSQAGFVQRKGRSILSIAGCSRSQP
GWDRVFGSHTFHEITNYWPTRFMRNRRFKYRRNICWKLDFLFAMDLYASRSWEGMRNASG
DKEPMIGPRRLRDYICRPPEELFDLENDPREVANLAGNPEYAEILKSMRDALESWQKSTG
DLWLWRDGAPVVRYLSSNYAREARALKRPVDSDTSVAYATYINFAEQDILENDDGLPTHP
LLPHYGKATYPITTDGNGRQQVEAHLSYWEGTYWIYAATWACGGSLLSYGRPAIDVANVT
KPLVRYSNSTGNYVLFMGGNDQSNFYYATSKAPGGPWSEPPSLMTGEHLTHDFDVAVGPD
GAHYILTDTWSNVTENQATGHSVPVWDIYVQKLAPNLTSTVGSNSTLALIRSAKDLHKQG
LNLEACGFFYHDSYWYQTYSYTCQNCPGYIYYLYAKDPLGPYTDGGYISLDGCGGQNKGA
NVLPSAKGPIVLAGNLAYRTSPTNHVLNRQIWHADNHQAASSTSFFPIEFNEDHTIKNFT
CPVIVKIPLVKNITSSPEPPVPYQLDCRIRNWQMIVQTFSKPKEVSTLDFPVWQRTDNLV
PTTNSGPMLDGVLNVTVIF

Enzyme Prediction     

No EC number prediction in FOC1_g10001941-t38_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH43	519	721	4.4e-16	0.5967741935483871

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
293751	SGSH	5.57e-124	6	417	2	373	N-sulfoglucosamine sulfohydrolase (SGSH; sulfamidase). N-sulfoglucosamine sulfohydrolase (SGSH) belongs to the sulfatase family and catalyses the cleavage of N-linked sulfate groups from the GAGs heparin sulfate and heparin. The active site is characterized by the amino-acid sequence motif C(X)PSR that is highly conserved among most sulfatases. The cysteine residue is post-translationally converted to a formylglycine (FGly) residue, which is crucial for the catalytic process. Loss of function of SGSH results a disease called mucopolysaccharidosis type IIIA (Sanfilippo A syndrome), a fatal childhood-onset neurodegenerative disease with mild facial, visceral and skeletal abnormalities.
293746	sulfatase_like	1.69e-61	6	271	2	225	sulfatase. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
293755	G6S_like	7.70e-60	6	413	4	427	unchracterized sulfatase homologous to glucosamine (N-acetyl)-6-sulfatase(G6S, GNS). N-acetylglucosamine-6-sulfatase also known as glucosamine (N-acetyl)-6-sulfatase hydrolyzes of the 6-sulfate groups of the N-acetyl-D-glucosamine 6-sulfate units of heparan sulfate and keratan sulfate. Deficiency of N-acetylglucosamine-6-sulfatase results in the disease of Sanfilippo Syndrome type IIId or Mucopolysaccharidosis III (MPS-III), a rare autosomal recessive lysosomal storage disease.
293771	sulfatase_like	4.24e-52	5	415	2	370	uncharacterized sulfatase subfamily. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
293757	sulfatase_like	2.72e-50	5	421	1	411	uncharacterized sulfatase subfamily. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEI60089.1|GH43	5.64e-268	448	859	31	484
CZS79584.1|GH43	2.50e-267	443	859	18	477
QPC69310.1|GH43	1.82e-264	444	859	18	476
CEF76293.1|GH43	1.15e-260	443	859	18	477
QPC57906.1|GH43	6.58e-260	443	859	18	477

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MHX_A	4.71e-75	5	424	23	480	Chain A, N-sulphoglucosamine sulphohydrolase [Homo sapiens],4MHX_B Chain B, N-sulphoglucosamine sulphohydrolase [Homo sapiens],4MIV_A Chain A, N-sulphoglucosamine sulphohydrolase [Homo sapiens],4MIV_B Chain B, N-sulphoglucosamine sulphohydrolase [Homo sapiens],4MIV_C Chain C, N-sulphoglucosamine sulphohydrolase [Homo sapiens],4MIV_D Chain D, N-sulphoglucosamine sulphohydrolase [Homo sapiens],4MIV_E Chain E, N-sulphoglucosamine sulphohydrolase [Homo sapiens],4MIV_F Chain F, N-sulphoglucosamine sulphohydrolase [Homo sapiens],4MIV_G Chain G, N-sulphoglucosamine sulphohydrolase [Homo sapiens],4MIV_H Chain H, N-sulphoglucosamine sulphohydrolase [Homo sapiens]
6HHM_A	1.77e-22	6	305	18	387	Crystal structure of the family S1_7 ulvan-specific sulfatase FA22070 from Formosa agariphila [Formosa agariphila]
7STT_A	6.54e-22	2	417	4	434	Chain A, N-acetylgalactosamine-6-sulfatase [Pedobacter yulinensis],7STU_A Chain A, N-acetylgalactosamine-6-sulfatase [Pedobacter yulinensis],7STV_A Chain A, N-acetylgalactosamine-6-sulfatase [Pedobacter yulinensis]
6PRM_A	9.52e-21	1	266	21	344	Crystal structure of apo PsS1_19B [Pseudoalteromonas fuliginea],6PRM_B Crystal structure of apo PsS1_19B [Pseudoalteromonas fuliginea],6PRM_C Crystal structure of apo PsS1_19B [Pseudoalteromonas fuliginea],6PRM_D Crystal structure of apo PsS1_19B [Pseudoalteromonas fuliginea]
7AN1_AAA	1.26e-20	2	274	27	400	Chain AAA, Arylsulfatase [Bacteroides thetaiotaomicron VPI-5482],7OQD_AAA Chain AAA, Arylsulfatase [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P51688|SPHM_HUMAN	7.43e-76	5	424	23	480	N-sulphoglucosamine sulphohydrolase OS=Homo sapiens OX=9606 GN=SGSH PE=1 SV=1
sp|T2KN71|PLH12_FORAG	1.86e-37	1	422	43	449	Ulvan-active sulfatase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22010 PE=1 SV=1
sp|T2KN90|PLH32_FORAG	4.21e-33	6	421	51	498	Ulvan-active sulfatase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22210 PE=1 SV=1
sp|T2KPK5|PLH18_FORAG	1.01e-21	6	305	31	400	Ulvan-active sulfatase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22070 PE=1 SV=2
sp|Q0TUK6|SULF_CLOP1	3.02e-20	6	412	4	451	Arylsulfatase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=CPF_0221 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000001

TMHMM  Annotations     

There is no transmembrane helices in FOC1_g10001941-t38_1-p1.