CAZyme Information: FGRAMPH1_01T28081-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T28081-p1
• CAZy Family: GT8
• CAZyme Description: 2-hydroxyacylsphingosine 1-beta-galactosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
514	HG970335|CGC21	56990.59	6.5679

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970335:7755323-7756996(-)

Full Sequence      

MYKLLFLGTVLVALVALLFPQQKDEHPPYVKGKNGTALFLVNQEHGISNVLVASASAMLE
TYPDIDIHFASFPKLKGKLERVSKFAKRKTPSARDIVFHQLKSPSYADVILNSGRSLDDV
PHPPGPAGISHLCKDIQLWISPWSAEEHFSIYEEISSLIEEIDPAVVVIDTLFRPGLDAT
RDKNRQHVFITPNQAVDNFLGEQPYGSMFWKYPSMSSGLPFPVPWNKIPENIYLNVRFIY
SVLRMPDVTAKRKALRERGLKDPINFFGMYRDDVPWITVTADGASIPVDYLPSNVTTTNP
IVLSVAPAIEQDPVLVEWLKKTPTVLINLGSTVSYSESQASIMTQAIANVLDKVDIQILW
KFNKVGTYSDDVFLPVKQHLDSGRLKLERWLTVDPTSLLESGLIVASIHHGGANCYNEAV
YAGVPHVILPLWADLYSYAALVETIGIGVWACPATSPKWTVEGLTHAFLRVLDGGEASVS
MREKARELGDKIQATEKGRDVAARKVAELAYSGV

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T28081-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	206	495	6.6e-19	0.6361256544502618

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.57e-24	104	509	38	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.67e-11	153	509	86	394	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
215127	PLN02210	4.26e-06	312	488	256	428	UDP-glucosyl transferase
278624	UDPGT	5.77e-05	325	449	278	386	UDP-glucoronosyl and UDP-glucosyl transferase.
273616	MGT	1.04e-04	406	489	294	377	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CZS74954.1|GT1	0.0	1	514	1	514
CEF84524.1|GT1	0.0	1	514	1	514
QPC63256.1|GT1	0.0	7	514	360	867
QPC72131.1|GT1	0.0	7	514	360	867
CEI41903.1|GT1	0.0	1	514	1	514

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2O6L_A	3.49e-07	325	434	24	117	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]
7CJX_A	1.49e-06	325	446	25	130	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
6IPB_A	2.17e-06	325	446	46	151	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1B4XBH6|SDNJ_SORAA	1.26e-76	33	481	4	462	Glycosyltransferase sdnJ OS=Sordaria araneosa OX=573841 GN=sdnJ PE=1 SV=1
sp|A0A411KZY6|BUAB_ASPBU	7.32e-56	32	498	3	463	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1
sp|A0A0D1DZV5|EMT1_USTMA	2.32e-09	385	477	442	531	Erythritol-mannosyl-transferase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EMT1 PE=1 SV=1
sp|Q9Y751|ATG26_KOMPG	5.32e-09	137	512	848	1181	Sterol 3-beta-glucosyltransferase OS=Komagataella phaffii (strain GS115 / ATCC 20864) OX=644223 GN=ATG26 PE=3 SV=1
sp|M9MH90|EMT1_PSEA3	3.77e-08	385	477	443	532	Erythritol-mannosyl-transferase 1 OS=Pseudozyma antarctica (strain T-34) OX=1151754 GN=EMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.847776	0.152248

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T28081-p1.