CAZyme Information: FGRAMPH1_01T27543-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T27543-p1
• CAZy Family: GT69
• CAZyme Description: GPI mannosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423	HG970335|CGC30	46250.42	9.3344

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970335:7147431-7148751(+)

Full Sequence      

MNLLDYKSRPILSLTSIFAAWKSFLLAIALGASIGPDYDTSTSLFFAIVHGASSPRSLAT
RLTRWDALYFMHDAVKGKVYEQEWAFGIGMPAAVRSICGLLNLQRWEALVAIAISHVSHL
VAVLALYQLTIVLCNDRKLAYLASVVHVLSPAGLFISAPYAESPFACMSFVGNLLYAISL
KSSPDSLKRNLAVVGAGLSYGISCTLRSNGLFGGVLFAVETVKCLLALRNGFSISKILRL
VAPLIGGILVAVGFVAPQVLAWMRYCNGNEEQRAWCGHRIPSIYTFVQAEYWDVGFLKYW
TPNQIPLFLLAAPMLTILLKSGTETMREPSRGLGAVAMGTNEESRLLVRTLAAIQTLLAV
LAITNYHVQIISRLSSGYPVWYWWVASCLMDKQRQSLGYGVIVFITMYAAIQGGLFASFL
PPA

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T27543-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	17	423	2e-112	0.9901719901719902

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	2.00e-35	62	423	57	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	7.95e-18	64	423	76	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF85209.1|GT76	1.74e-307	1	423	1	423
CZS74683.1|GT76	8.25e-306	1	423	1	423
QPC72356.1|GT76	2.32e-296	1	423	1	423
QPC63474.1|GT76	9.45e-296	1	423	1	423
CEI41323.1|GT76	4.64e-275	1	423	1	421

PDB Hits     

FGRAMPH1_01T27543-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I0K3|GPI18_GIBZE	3.08e-308	1	423	1	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	5.43e-111	8	423	16	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	4.42e-87	9	423	28	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q2UJS7|GPI18_ASPOR	2.50e-84	2	423	11	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	2.15e-59	13	423	6	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999568	0.000451

TMHMM  Annotations     

Start	End
12	34
110	132
139	161
197	219
240	262
300	319
397	419