CAZyme Information: FGRAMPH1_01T27273-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T27273-p1
• CAZy Family: GT64
• CAZyme Description: phosphatidylcholine-sterol acyltransferase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
301	HG970335|CGC16	32850.85	5.2625

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970335:6806129-6807136(+)

Full Sequence      

MLSSWVIGLCASSLVRALPVSDYYTVKAPRLIVFGDSFSDNGNGSWIVSNGTWPADPAYY
RHSFSNGLKWNDLVAKDLGLELINLATGGATTNNNFVAGGTGAQSTIPVPSASDQVFSFL
SWNKPRPDDVFVHWIGANDILFNTSITGGQVTSLINENVDRLYHAGAKRIILANYLKITT
FPATYSSPDYDIPSVEVYSSALTQGLKNIAAAYSAYAQTAVIDVGNLFKDITLDPESYGF
DEKYLNPPTACLTGVYTSEGVPRHLCNDPQKHVFFDSYHPGKEVHALIAKLFEQEIRQFS
G

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T27273-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	31	291	5.6e-26	0.9887640449438202

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	2.24e-69	30	294	1	269	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
238875	SGNH_plant_lipase_like	6.60e-28	29	292	1	311	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238883	Triacylglycerol_lipase_like	9.31e-23	30	289	3	274	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
225780	COG3240	6.76e-17	30	289	31	326	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
185279	PRK15381	5.11e-14	30	296	144	401	type III secretion system effector.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPC63584.1|CE0	2.21e-221	1	301	1	301
QPC72470.1|CE0	3.01e-219	1	301	1	301
QGI61065.1|CE0	7.47e-165	1	300	3	300
UPL02629.1|CE0	4.88e-137	10	300	11	298
UJO20625.1|CE0	8.08e-110	9	298	10	300

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JL1_A	1.84e-20	30	290	146	404	Crystal structure of VvPlpA G389D from Vibrio vulnificus [Vibrio vulnificus]
6JL2_A	8.64e-20	30	290	146	404	Crystal structure of VvPlpA G389N from Vibrio vulnificus [Vibrio vulnificus],6JL2_B Crystal structure of VvPlpA G389N from Vibrio vulnificus [Vibrio vulnificus],6JL2_C Crystal structure of VvPlpA G389N from Vibrio vulnificus [Vibrio vulnificus]
6JKZ_A	1.60e-19	30	290	146	404	Crystal structure of VvPlpA from Vibrio vulnificus [Vibrio vulnificus],6JL0_A Crystal structure of VvPlpA from Vibrio vulnificus [Vibrio vulnificus]
6UQV_A	3.58e-11	30	287	11	276	Crystal structure of ChoE, a bacterial acetylcholinesterase from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1],6UQW_A Crystal structure of ChoE in complex with acetate and thiocholine [Pseudomonas aeruginosa PAO1],6UQW_B Crystal structure of ChoE in complex with acetate and thiocholine [Pseudomonas aeruginosa PAO1],6UQX_A Crystal structure of ChoE in complex with propionylthiocholine [Pseudomonas aeruginosa PAO1],6UQX_B Crystal structure of ChoE in complex with propionylthiocholine [Pseudomonas aeruginosa PAO1]
6UR1_A	8.84e-11	30	287	11	276	Crystal structure of ChoE S38A mutant in complex with acetate and acetylthiocholine [Pseudomonas aeruginosa PAO1],6UR1_B Crystal structure of ChoE S38A mutant in complex with acetate and acetylthiocholine [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P10480|GCAT_AERHY	7.34e-19	30	256	27	248	Phosphatidylcholine-sterol acyltransferase OS=Aeromonas hydrophila OX=644 PE=1 SV=3
sp|Q99289|HLT_VIBPA	3.15e-17	30	290	146	404	Thermolabile hemolysin OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=VPA0226 PE=1 SV=2
sp|G2QJ27|AES1_MYCTT	1.52e-10	8	290	17	291	Acetylesterase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=aes1 PE=3 SV=1
sp|T2FKR1|AES1_THETO	1.52e-10	8	290	17	291	Acetylesterase OS=Thermothelomyces thermophilus OX=78579 GN=aes1 PE=1 SV=1
sp|Q9SIZ6|GDL47_ARATH	1.53e-10	31	296	37	357	GDSL esterase/lipase At2g40250 OS=Arabidopsis thaliana OX=3702 GN=At2g40250 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000307	0.999672	CS pos: 17-18. Pr: 0.9796

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T27273-p1.