CAZyme Information: FGRAMPH1_01T27237-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T27237-p1
• CAZy Family: PL3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
471	HG970335|CGC37	53695.14	8.4025

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970335:6759790-6761205(+)

Full Sequence      

MSDSVLSKVGALAILVILIIISGFRWYRLLLHRRGLKAYRPTPRGKSPRDNDLQDIAVIL
PVVDHQSDNFIPTVKSILWNFPGQLYVVVVGRDAYDKVEPQMAALRKKYEHSQIHIGAVN
KASRRRQIAHALGTINHRDFRLTVITEQGAYWPPRFLPSACYPFDDQYVSAVTVPKMAHL
PLQGGIWAHVKAYLFSFHYCVQAEDNCVVNCLDCSALFGGPTTLVRTYVLKENRFKDEFE
KEMWFHERFGPLTGGEHFFLNRYLLGGNKKIFFQDSPDATVSVEMNSICEFIGEFLRTTR
DNWRTCYSIAPQCASLYYHHGHVIYPAATRMTWWPTIFSLATQIDLLTIVLVLNDNLLNK
AAFCVFIIAAFLMATAQAVLGLLVVRRMQRNNFDVIAPLSCALLSLSFQCALNLLKGVAL
LTFWKTDDESASQNIEVPGERNLPWSWDFNEGDWDRDMPFGGSWLLFKAKK

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T27237-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133056	GT2_HAS	3.88e-23	55	305	1	235	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF85567.1|GT0	0.0	1	471	1	471
CZS74529.1|GT0	0.0	1	471	1	471
QPC63602.1|GT0	0.0	1	471	1	471
QPC72485.1|GT0	0.0	1	471	1	471
CEI41021.1|GT0	1.42e-157	1	447	1	415

PDB Hits     

FGRAMPH1_01T27237-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G4MWY1|GT2_MAGO7	8.06e-16	25	305	43	312	Type 2 glycosyltransferase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=GT2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000000

TMHMM  Annotations     

Start	End
10	29
331	353
363	385