CAZyme Information: FGRAMPH1_01T26345-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T26345-p1
• CAZy Family: GT4
• CAZyme Description: glycoside hydrolase family 16

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
965	HG970335|CGC9	101422.84	3.8470

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970335:5443201-5446319(+)

Full Sequence      

MAYSLTNSFIGESFLSGFEWFNGTDLSKGFVQYQDFTGAFKNGLYSVDPFSETVQLRPDS
RHKYGLDEGRPSIRLESKESYQYGLFIADFQHMPISQCGTWPAFWAYGSNWPMGGEIDIL
EGANLAYTNIMSAHTAEGCMLDPADSNLFSGIRRNLDCGVGTNNVGCGFNPPKSDTSSYG
DGFNAVGGGVYAMEWDSEYISIWHFPRGAIPADIEAKQPDPRNWGLPQSLFGGAKCDVDK
YFSDMKLVLNINFCGDYGEGTWANSKVCKALAPTCREYVANNPTAFKEAYFDVSYIDVYT
RLGGNIPPILPSSASEASTQASDVIITGESATTTPMSGRPVFPSTNFHDNSTIATRTDRK
GKATQSEEPTTTTTLTMTGISSVLVTIPGSGTDTPTVTPLPVATGGKSANPSKIGDYSYL
GCFGSQNGFQTFDLADDSDDMTIERCVDACNGLTYIGLFEGTCYCASVLDGDTLAISNET
SCNRPCPGDDAQFCGGMVTQNTRTRFRRTTPLRRDAPSNVLLTVYADISDVELPEVPPAM
GPGTNDISTDDGDSQGDSATDESESPTTSDDKASQGASDAAEPENSGDSDATTSQESTNA
DGSEDLTASNDNGTQGGSTTDDPDDSTASDGNASQRGSESEDSKILPVLNDNIDASLAGS
ASSPGSSAQGSSDEQDSSDDQDDPDSYGNSILPSAAGVVLSDDQDTSPVAVIGTASDGLV
LGATQSAADSNQELFLSTITYFTVMPSNPGSLVPQQGIITMSYEKCDYCETPELIKPPME
TKVVDCDGCGPNGEDTVTLTVPISVTVTVPGASTEQAQQTEKAAAEAVTSYGGSPEQPPR
NSTILPAVPNGMGSGAEAGESPEVTTVVITYLTTQLVTYGTSTDSVSTVTRTARRTVVIT
VSDSDGQMSILPISSPGQPNTPVTIATPTPGAPSEPVAISAAASRRDDVFVYFAIVAMAI
LALTL

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T26345-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	51	279	2e-79	0.9563318777292577

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185690	GH16_fungal_Lam16A_glucanase	3.87e-136	2	300	1	293	fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Group of fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Lam16A belongs to the 'nonspecific' 1,3(4)-beta-glucanase subfamily, although beta-1,6 branching and beta-1,4 bonds specifically define where Lam16A hydrolyzes its substrates, like curdlan (beta-1,3-glucan), lichenin (beta-1,3-1,4-mixed linkage glucan), and laminarin (beta-1,6-branched-1,3-glucan).
396406	WSC	1.61e-14	420	496	1	80	WSC domain. This domain may be involved in carbohydrate binding.
185693	GH16_laminarinase_like	3.19e-12	72	200	66	172	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
214616	WSC	1.20e-07	416	496	1	85	present in yeast cell wall integrity and stress response component proteins. Domain present in WSC proteins, polycystin and fungal exoglucanase
185694	GH16_CCF	1.19e-05	101	203	130	222	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF85685.1|GH16_1	0.0	1	965	1	965
CZS74085.1|GH16_1	0.0	1	965	1	965
QPC64001.1|GH16_1	0.0	1	965	1	964
QPC72836.1|GH16_1	0.0	1	965	1	973
CEI40256.1|GH16_1	0.0	1	965	1	938

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JVV_A	1.57e-65	2	300	2	298	Crystal structure and characterization an elongating GH family 16 beta-1,3-glucosyltransferase [Paecilomyces sp. 'thermophila'],5JVV_B Crystal structure and characterization an elongating GH family 16 beta-1,3-glucosyltransferase [Paecilomyces sp. 'thermophila']
3WDU_A	7.13e-64	11	299	11	295	The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_B The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_C The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila'],3WDU_D The complex structure of PtLic16A with cellobiose [Paecilomyces sp. 'thermophila']
3WDT_A	7.35e-64	11	299	12	296	The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_B The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_C The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDT_D The apo-form structure of PtLic16A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDV_A The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_B The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_C The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDV_D The complex structure of PtLic16A with cellotetraose [Paecilomyces sp. 'thermophila']
3WDY_A	4.71e-63	11	299	10	294	The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_B The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_C The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila'],3WDY_D The complex structure of E113A with cellotetraose [Paecilomyces sp. 'thermophila']
3WDW_A	5.00e-63	11	299	12	296	The apo-form structure of E113A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDW_B The apo-form structure of E113A from Paecilomyces thermophila [Paecilomyces sp. 'thermophila'],3WDX_A The complex structure of E113A with glucotriose [Paecilomyces sp. 'thermophila'],3WDX_B The complex structure of E113A with glucotriose [Paecilomyces sp. 'thermophila']

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9USW3|YHZ7_SCHPO	2.80e-70	3	299	129	417	Probable glycosidase C21B10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC21B10.07 PE=3 SV=1
sp|D4AJR9|EGLX_ARTBC	1.08e-69	3	350	20	375	Endo-1,3(4)-beta-glucanase ARB_04519 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04519 PE=3 SV=1
sp|B8N7S7|EGLX_ASPFN	5.77e-66	3	336	31	362	Probable endo-1,3(4)-beta-glucanase AFLA_105200 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=AFLA_105200 PE=3 SV=1
sp|Q2UIE6|EGLX_ASPOR	1.32e-64	3	334	31	360	Probable endo-1,3(4)-beta-glucanase AO090023000083 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090023000083 PE=3 SV=1
sp|A1C7B5|EGLX_ASPCL	1.78e-63	2	318	32	345	Probable endo-1,3(4)-beta-glucanase ACLA_073210 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=ACLA_073210 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000015

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T26345-p1.