CAZyme Information: FGRAMPH1_01T25625-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T25625-p1
• CAZy Family: GT31
• CAZyme Description: unnamed protein product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
494		54437.44	5.8846

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970335:4454514-4456432(-)

Full Sequence      

MKPTQVLVALAAIAYAAPVSDDTKAKALEIDDDFPLAELEAYFEAHMNGETSEANSLHAR
QFSSSTYNQLTDGTPCRPVTMIYARGTTQAGNVGDPAAVGPVLFNNLASRIGLNNLAVQG
VAYPANIAGYLAGGDAAGSRTMADLISRAATQCPSTKIIISGYSQGAQLVHNAAGMLSAS
VTNRVTAAVTFGDPKQKQAFGTIPSSRTRIFCRAGDNICDGGIIVTPAHSQYQQDAPAAA
EWIAARSDPYYGAQVFVANINTMSHKVEWIFLKIKNSYHDNIERLAISKWAPQLSAEINL
PDWVEDELREILIYEIIKTHMTQPFNRYSWIILRNMFGHDFDHHGKSATFLGHVFSVIAK
IVLQTEDVDQQFWLDNMHLLTLGCFEIINDKTVDFTQGLLSDAGRLKAFFTPLLISAFPV
VNGKLKNDEKTNSNHKKLRKHMTDRKSEKSSTLIKDEADFDDEDGPELKVEEEEEELGTR
RTITFNSRKFNSVP

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T25625-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	75	246	5.7e-43	0.9894179894179894

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	4.12e-59	75	235	1	160	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF84782.1|CE5	0.0	1	494	1	494
CZS73725.1|CE5	0.0	1	494	1	494
QPC73178.1|CE5	2.06e-222	1	482	1	1029
QPC64283.1|CE5	8.35e-158	1	255	1	255
CEI39834.1|CE5	3.76e-154	1	246	1	250

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4PSC_A	2.41e-36	71	243	74	243	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
1FFA_A	6.63e-29	51	240	4	199	Chain A, CUTINASE [Fusarium vanettenii]
1FFC_A	6.63e-29	51	240	4	199	Chain A, CUTINASE [Fusarium vanettenii]
1FFD_A	6.63e-29	51	240	4	199	Chain A, CUTINASE [Fusarium vanettenii]
1FFB_A	2.39e-28	51	240	4	199	Chain A, CUTINASE [Fusarium vanettenii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q00298|CUTI_BOTFU	9.46e-45	76	243	31	196	Cutinase OS=Botryotinia fuckeliana OX=40559 GN=cutA PE=1 SV=1
sp|G4MZV6|CUTI2_MAGO7	3.81e-43	57	246	22	213	Cutinase CUT2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=CUT2 PE=1 SV=1
sp|Q8TGB8|CUTI_MONFR	3.86e-41	76	243	31	195	Cutinase OS=Monilinia fructicola OX=38448 GN=CUT1 PE=2 SV=1
sp|Q8X1P1|CUTI_BLUHO	7.51e-41	63	246	55	235	Cutinase OS=Blumeria hordei OX=2867405 GN=CUT1 PE=3 SV=1
sp|Q9Y7G8|CUTI_PYRBR	1.60e-38	76	247	32	201	Cutinase pbc1 OS=Pyrenopeziza brassicae OX=76659 GN=pbc1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000242	0.999746	CS pos: 16-17. Pr: 0.9552

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T25625-p1.