CAZyme Information: FGRAMPH1_01T25391-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T25391-p1
• CAZy Family: GT2|GT2
• CAZyme Description: TPA_inf: intracellular beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1024	HG970335|CGC37	116438.49	4.9984

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970335:4203860-4207033(-)

Full Sequence      

MDSSVEKPDYENLEVIQRNRLPARAYWLPPAHLILNGQWDFQYAPSPLEASEYPPKDEKS
DEAWAPITVPGHWQLQGYGRPHYTNVQFPFPSAPPFIPTENPTGIYRRSFKVPDEWDSNS
QLRLRFDGVDSAYHVWLNGEFVGYSQGSRNAAEFDVTSVVKKDEENDLVVRVYQWCEASY
IEDQDQWWLSGIFRDVTLLSFPEARIEDYFVKTNLDAQYQDAALAVDITLHHAENDPLEL
SLVLRDGDKQVASTEKVLDDKDATFKFEVPVANPKKWTAESPYLYQLEIALKAPDAKVIQ
KITQNVGFRKVELKNSLITVNGTPILLRGANRHDHHPLHGRAVPYDFLKQDLLLMKQHNI
NALRTSHYPGQPWLYDLADELGFWVMDEADLECHGFYDVVTQPVQPPPYLDYEGSKEEYF
PKAAQFTSDDPEWHDSYLDRMVQMVQRDKNHPCIFSWSLGNESFYGANHVAMIEYARSVD
DRLIHYEGDIKAQLTDMYSYMYPDQDRLKRHVEIDGIEDGKWQKPVILCEYAHAMGNGPG
GLDDYQDAFRKYERLQGGFIWEWANHGLLHKDGYYAYGGDFGDEPNDSTFVMDGLVNSEH
KPTPGLTELKKVFQPVKFEAKSGKVFITNEYDFIGLGHLEGEFSVQAMGDKVSLLESGKV
EIPEVKPWETVELALPDLTQYQSHDEEVFLQVSFNLKEATKWAPASHKIAWFQHKISTDK
EATTPASSTTAQAIDVKESRAAVEVSGADWAIKFDRVRGYITKWSHGTDLLEMDTATRAA
IHPCFWRAPTDNDKDSAVSVWKDYGVHRMTSQLRSFQVQKDDESVTVKTVTYLAPPVLGW
GYDITTNYRISSGGIVSMKLDLVPKGVFPKDVPRLGLNLRLPKTLNQVDWFGRGPGESYP
DKKHSQAIGIWSSSVDGLEVPYDVPQGHGNRMETRWVRVVDADGHGIRASRRDQSTFDWT
GSRLSDETVEKAKHPCDLVREQATLLNLSAKVAGVGSATCGPGVREDLKVKVEPISYEFV
LQRI

Enzyme Prediction     

EC	3.2.1.23:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	34	908	7.1e-231	0.9574468085106383

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236548	lacZ	0.0	9	996	16	998	beta-galactosidase.
236673	ebgA	0.0	10	1021	4	997	cryptic beta-D-galactosidase subunit alpha; Reviewed
225789	LacZ	9.54e-180	35	910	15	808	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
397119	Glyco_hydro_2_C	6.46e-119	311	618	1	302	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
214988	Bgal_small_N	6.52e-89	746	1021	1	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF83262.1|GH2	0.0	1	1024	1	1024
CZS73611.1|GH2	0.0	1	1024	1	1024
QPC73255.1|GH2	0.0	1	1024	1	1024
QPC64362.1|GH2	0.0	1	1024	1	1040
CEI39959.1|GH2	0.0	1	1024	35	1060

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3OB8_A	1.41e-252	12	1021	18	1029	Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_B Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_C Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_D Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OBA_A Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_B Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_C Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_D Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis]
6S6Z_A	7.52e-197	22	1019	27	975	Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	7.73e-197	22	1019	28	976	Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6CVM_A	1.61e-187	5	1020	10	1018	Atomic resolution cryo-EM structure of beta-galactosidase [Escherichia coli K-12],6CVM_B Atomic resolution cryo-EM structure of beta-galactosidase [Escherichia coli K-12],6CVM_C Atomic resolution cryo-EM structure of beta-galactosidase [Escherichia coli K-12],6CVM_D Atomic resolution cryo-EM structure of beta-galactosidase [Escherichia coli K-12],6X1Q_A 1.8 Angstrom resolution structure of b-galactosidase with a 200 kV cryoARM electron microscope [Escherichia coli K-12],6X1Q_B 1.8 Angstrom resolution structure of b-galactosidase with a 200 kV cryoARM electron microscope [Escherichia coli K-12],6X1Q_C 1.8 Angstrom resolution structure of b-galactosidase with a 200 kV cryoARM electron microscope [Escherichia coli K-12],6X1Q_D 1.8 Angstrom resolution structure of b-galactosidase with a 200 kV cryoARM electron microscope [Escherichia coli K-12]
1JZ7_A	2.40e-187	5	1020	11	1019	E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_B E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_C E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],1JZ7_D E. COLI (lacZ) BETA-GALACTOSIDASE IN COMPLEX WITH GALACTOSE [Escherichia coli],4TTG_A Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_B Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_C Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli],4TTG_D Beta-galactosidase (E. coli) in the presence of potassium chloride. [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P00723|BGAL_KLULA	5.84e-252	12	1021	11	1022	Beta-galactosidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=LAC4 PE=1 SV=2
sp|P06864|BGA2_ECOLI	7.25e-220	10	1021	4	997	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
sp|Q56307|BGAL_THEMA	3.98e-196	22	1019	28	976	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
sp|A5F5U6|BGAL_VIBC3	6.27e-195	35	996	50	990	Beta-galactosidase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=lacZ PE=3 SV=2
sp|Q2XQU3|BGAL2_ENTCL	2.41e-192	1	1023	9	1027	Beta-galactosidase 2 OS=Enterobacter cloacae OX=550 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T25391-p1.