CAZyme Information: FGRAMPH1_01T22463-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T22463-p1
• CAZy Family: GT109
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311		32302.67	3.5819

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970335:281787-282722(-)

Full Sequence      

MKNAAAILALIPLVAAHGFIKSPAPRRPGDAYKAACGDQPFYQQSSDINGNVQGIKQVVG
QDFKAADCNLWLCKGFQFDDNKDNVQKYSLGEKIPFEINIAAPHTGYANVSVVKTSSDTM
IGEPLIEFENYAANAGTASNNTAFSVTLPTSLGGDCTKAGECVLQWFWDAPDINQTYESC
VDFVVGAGSGSAPAPSSGSGAEKPATSAPAAEQPAATSAAAEADDEDCDDEEEPAASTTA
VAEKPAATTLQAVAISSAADSGSAQPTSAPGSDDDEDCDDEEPIADEDEDCDEEDDQDAG
DEDEECPADDY

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T22463-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA16	17	183	1.2e-71	0.9940119760479041

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397269	LPMO_10	1.12e-08	17	183	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.
237057	PRK12323	0.009	186	310	369	494	DNA polymerase III subunit gamma/tau.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF84218.1|AA16	3.25e-187	1	311	1	311
CZS72147.1|AA16	3.25e-187	1	311	1	311
QPC65560.1|AA16	1.04e-183	1	311	1	311
QPC74432.1|AA16	9.89e-182	1	311	1	311
CEI38513.1|AA16	8.87e-136	1	266	1	270

PDB Hits     

FGRAMPH1_01T22463-p1 has no PDB hit.

Swiss-Prot Hits     

FGRAMPH1_01T22463-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000353	0.999651	CS pos: 16-17. Pr: 0.9705

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T22463-p1.