CAZyme Information: FGRAMPH1_01T22295-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T22295-p1
• CAZy Family: GT1
• CAZyme Description: glycosyl hydrolase family 10

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354	HG970335|CGC4	39335.59	8.9083

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970335:66495-67777(+)

Full Sequence      

MAWLQPTLCRKELESRQTSGLDAAMKAAGKKYFGTALTVRNDAGETNVLNTKGEFGSITP
ENAMKWEAIQPNRGQFNWGPADQHANAATQRGMELRCHTLVWHSQLPSWVANGNWNNQTL
QQVMKDHINAVMGRYKGKCTHWDVVNEALNEDGTYRDSVFYRVIGEAFIPIAFRMVLAAD
PTTKLYYNDYNLEYGGAKTAGAIRITKLIQSYGLRIDGVGLQAHMTSESTPTQSTVTPSR
ANLASVLNSFTKLNVDVAYTELDIRMNTPANQQKLQANAAAYARMVGSCMDVKRCVGVTV
WGISDKYSWVPGTFPGEGSALLWDDNFNKKPSYTSSLNTIRACWKCHRLLVSIS

Enzyme Prediction     

EC	3.2.1.8:2	3.2.1.4:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	21	337	1.3e-100	0.9867986798679867

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	3.27e-145	21	338	1	310	Glycosyl hydrolase family 10.
214750	Glyco_10	6.69e-114	64	335	1	262	Glycosyl hydrolase family 10.
226217	XynA	1.55e-89	13	333	16	334	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF83669.1|GH10	8.24e-271	1	354	1	354
CZS72066.1|GH10	1.59e-268	1	354	1	354
QPC65619.1|GH10	8.57e-249	11	341	26	356
QPC74491.1|GH10	1.26e-245	12	341	25	354
CEI38415.1|GH10	2.25e-244	11	341	26	356

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3U7B_A	1.72e-214	19	340	3	324	A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_B A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_C A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_D A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum],3U7B_E A new crystal structure of a Fusarium oxysporum GH10 xylanase reveals the presence of an extended loop on top of the catalytic cleft [Fusarium oxysporum]
6JDT_A	2.85e-119	19	333	1	310	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
6Q8M_A	9.46e-116	20	337	24	336	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
3WUF_A	1.60e-91	18	333	2	305	The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
1V6Y_A	9.16e-91	19	335	3	309	Crystal Structure Of chimeric Xylanase between Streptomyces Olivaceoviridis E-86 FXYN and Cellulomonas fimi Cex [Streptomyces olivaceoviridis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|I1RQU5|XYN1_GIBZE	1.46e-271	1	354	1	354	Endo-1,4-beta-xylanase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=XYL1 PE=1 SV=1
sp|B3A0S5|XYNA_FUSO4	8.87e-214	19	340	3	324	Endo-1,4-beta-xylanase A OS=Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) OX=426428 GN=FOXG_17421 PE=1 SV=1
sp|Q2PGV8|XYN2_AURPU	1.39e-148	17	342	30	357	Endo-1,4-beta-xylanase 2 OS=Aureobasidium pullulans OX=5580 GN=xynII PE=1 SV=1
sp|P79046|XYN1_HUMGT	2.46e-123	28	335	28	332	Endo-1,4-beta-xylanase 1 OS=Humicola grisea var. thermoidea OX=5528 GN=xyn1 PE=2 SV=1
sp|Q5ZNB1|XYND_TALFU	5.29e-112	21	333	21	327	Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus OX=28572 GN=xynD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T22295-p1.