CAZyme Information: FGRAMPH1_01T22039-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T22039-p1
• CAZy Family: GT1
• CAZyme Description: feruloyl esterase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
297	HG970334|CGC14	32048.25	8.4418

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970334:7553121-7554072(-)

Full Sequence      

MLDFLSPRKLLTQLTLGAGLVAAQLQTISNFGPTYDTRLVMQAYVPSNLPANAAVMVALH
PCGGTGPGYFQQTKYKSLADSRGVILIFPSSPKDSNCWDVASTKTLKHGGQGDSQVIVSM
VDYAINTWKADRNKVFVTGTSSGCMMTNVLAATYPDRFAAATCYSGVAAGCMAGSPGSSP
ISSDRKCSDGKIVKSGQEWANQVKAMYPGYSGSYPRFKTWHGTADYLVTYQNLQEQIKEW
STLHGVSLTSSQQNTPQPNYTTMIYGDGTKFVAVSAAGVGHVVPTHEDDDFKWFRLT

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T22039-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	37	235	8.3e-24	0.7929515418502202

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	7.23e-39	41	249	1	203	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
226040	LpqC	1.06e-20	8	284	9	277	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	3.20e-15	44	173	6	137	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
224423	DAP2	3.22e-06	108	167	448	507	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
226584	COG4099	9.02e-06	13	166	148	302	Predicted peptidase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF87015.1|CE1	2.68e-220	1	297	1	297
CZS86120.1|CE1	4.45e-219	1	297	1	297
QPC63089.1|CE1	8.98e-219	1	297	1	297
QPC80396.1|CE1	7.38e-218	1	297	1	297
CEI70802.1|CE1	6.11e-199	1	296	1	297

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	1.85e-79	22	294	1	272	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9HE18|FAEB_TALFU	9.14e-90	21	297	17	292	Feruloyl esterase B OS=Talaromyces funiculosus OX=28572 GN=FAEB PE=1 SV=1
sp|B8M9H9|FAEB_TALSN	8.59e-89	22	297	18	292	Feruloyl esterase B OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) OX=441959 GN=faeB PE=1 SV=1
sp|Q9HGR3|FAEB_NEUCR	4.05e-79	7	296	3	290	Feruloyl esterase B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=fae-1 PE=2 SV=2
sp|A2QZI3|AXE1_ASPNC	5.72e-79	22	294	29	300	Probable acetylxylan esterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=axeA PE=3 SV=1
sp|Q96W96|AXE1_ASPFI	8.09e-79	22	294	29	300	Acetylxylan esterase A OS=Aspergillus ficuum OX=5058 GN=axeA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.321755	0.678238	CS pos: 27-28. Pr: 0.1689

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T22039-p1.