CAZyme Information: FGRAMPH1_01T21825-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T21825-p1
• CAZy Family: PL4
• CAZyme Description: UDP-glycosyltransferase 84B2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
516	HG970334|CGC5	57462.27	7.2729

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970334:7311262-7312906(-)

Full Sequence      

MTTTKRLLFFTNSDYGQANVVLATAHAIGLENPNVEIHIASFQELEASVDNSSKFMQKSA
SQQKLPIPKSFIFHKINGISWGPATKRPGTAIFDTLELTPGFVNSAKGVATLPAVMVPWT
PEEYMEIYWDTQRVYDEVKPDLTIVEPLYTHGLTFCHYRGVRWMVLSPNTIKEFAVPLQP
KLAALWKYPMACSALPYPIPWSLIPTNIAFSLVAGYTLLTNTRLKNATNILRKKVNPSIQ
LMTMMELGVLKPAPANLPILVANSPDIDYPFTVIPPQLTSCGPIVRAAPHIREVDPDLAA
WLSRGPTIYINLGTHHKSSPDEAHEMAKALKKVLDKSDAQESKERPLQLLWKLGRTPDDE
GNAPQQDSYNGVWALVLDELQVHIKQDKVRVTDWLVAEPKSVIESKNIVCSVNHGGANSF
HEGLCAGIPQVLLPAWTDCYDFANRVELLGIGRWGNKKAKPRWEKDELCDAIMDTIFGPG
SARIQKTAREVAACHPEWEGRQKAAKEIIDYLTCTP

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T21825-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.69e-19	84	511	49	404	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	3.41e-12	176	510	104	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
215127	PLN02210	1.53e-11	301	491	262	428	UDP-glucosyl transferase
178170	PLN02555	6.16e-06	291	489	260	440	limonoid glucosyltransferase
177830	PLN02173	2.03e-05	301	438	257	366	UDP-glucosyl transferase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF85929.1|GT1	0.0	1	516	1	516
CZS86005.1|GT1	0.0	1	516	1	516
QPC80334.1|GT1	0.0	1	515	1	515
CEI70655.1|GT1	0.0	1	512	1	512
CCT74337.1|GT1	3.20e-278	1	512	1	509

PDB Hits     

FGRAMPH1_01T21825-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A411KZY6|BUAB_ASPBU	5.16e-67	7	513	8	489	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1
sp|A0A1B4XBH6|SDNJ_SORAA	1.67e-56	7	512	8	505	Glycosyltransferase sdnJ OS=Sordaria araneosa OX=573841 GN=sdnJ PE=1 SV=1
sp|A0A0D1DZV5|EMT1_USTMA	5.40e-09	389	510	442	559	Erythritol-mannosyl-transferase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=EMT1 PE=1 SV=1
sp|O22182|U84B1_ARATH	7.02e-08	301	491	262	428	UDP-glycosyltransferase 84B1 OS=Arabidopsis thaliana OX=3702 GN=UGT84B1 PE=2 SV=1
sp|M9MH90|EMT1_PSEA3	8.74e-08	389	489	443	540	Erythritol-mannosyl-transferase 1 OS=Pseudozyma antarctica (strain T-34) OX=1151754 GN=EMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000025	0.000001

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T21825-p1.