CAZyme Information: FGRAMPH1_01T21617-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T21617-p1
• CAZy Family: GH79
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
438	HG970334|CGC41	49106.02	6.3711

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970334:7086913-7088369(+)

Full Sequence      

MRLSSIFLSLTSLMATTTALKIKSTKQWTIGTDIQGSERLNGVSYQEDALVTYGNYQYVT
FYETAPAGYLNHFVRLGRRKISPSIADWEYLTLDDYTQKTMDGHNMISMGISGDGKIHLS
FDHHDVPINYRVSKAGIAKDVPSKWSSELFGPVVHTLDGSQGPYSPLTYPRFEPLPNGDL
LLEFRIGQSGSGDSYIHRYSSSTGKWQAQGMYIQGDDNNAYINGLDYLDGKLYTSWTVRE
TPNADTNHGVYFAYSNDDGMTWFNTNGTKLTKPISTSDASTLIWDIPQNSRMVNQEGQLV
DTKGRFHILMRDLLSGKHLYQHYLRDTNGKWTKNAINPAGLNGPDLYDPRGKLAGDATGE
YLFGLLPDPVKQSTGIYVATASKGFKDWMSLAEIPNTATEPLFDRTRLHEFGVLSVFVRQ
AGGFPDRKLQVWDFELDL

Enzyme Prediction     

EC	4.2.2.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL42	40	337	1.5e-97	0.9493243243243243

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406346	BNR_4	8.36e-72	56	333	1	268	BNR repeat-containing family member. BNR_4 is a family which carries the unique sequence motif SxDxGxTW which is so characteristic of the repeats of the BNR family, pfam02012. It is unclear whether or not this unit is repeated throughout the sequences of this family, but if it is then the family is likely to be bacterial neuraminidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SCB65023.1|PL42	0.0	1	438	1	438
QPC62903.1|PL42	0.0	1	438	1	438
CZS85905.1|PL42	0.0	14	438	1	425
QPC80263.1|PL42	0.0	1	438	1	438
CEI70604.1|PL42	0.0	1	438	1	438

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7ESK_A	1.09e-297	20	438	3	421	Chain A, L-Rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum],7ESM_A Chain A, L-rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum]
7ESL_A	1.80e-296	20	438	3	421	Chain A, L-rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum]
7ESN_A	2.76e-296	20	438	5	423	Chain A, L-Rhamnose-alpha-1,4-D-glucuronate lyase [Fusarium oxysporum]
5MUM_A	6.80e-42	40	308	40	288	Glycoside Hydrolase BACINT_00347 [Bacteroides intestinalis DSM 17393]
5MVH_A	4.76e-41	40	411	35	400	Glycoside Hydrolase BACCELL_00856 [Bacteroides cellulosilyticus DSM 14838]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A109PTH9|UL24S_ALTSL	1.66e-12	102	278	150	370	Ulvan lyase, short isoform OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_107 PE=1 SV=1
sp|A0A0X9SHN5|UL24S_PSEXP	8.85e-11	102	278	150	370	Ulvan lyase, short isoform OS=Pseudoalteromonas sp. (strain PLSV) OX=1547444 GN=PLSV_3875 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000291	0.999690	CS pos: 19-20. Pr: 0.9756

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T21617-p1.