CAZyme Information: FGRAMPH1_01T21541-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T21541-p1
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
241	HG970334|CGC52	25995.46	10.3057

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970334:6980048-6980773(+)

Full Sequence      

MLSTLRRFFAMVVMLMAFSATALPNIRVLPLGDSITKGTGSTGLVGYRLPLRQKILAQGV
KVNMVGTLKNGNMVDGHHEGHSGKLLSDINGYWQVPMKARPNVVLIHAGTNNMDRGIDLD
IAADIMADIVDGIFKIASDVTILLAPVIWANVPTMQANTDKFNVKVRSLIAARQKSGKKI
LEVPIDIKKADLGDSKHPNDAGYEKMANAWLKAILEADKKGWLKTPVKMSESDAPGTGLG
A

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T21541-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	26	214	3e-48	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	9.68e-48	26	214	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	4.28e-15	31	205	2	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	1.25e-11	28	213	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238872	SGNH_hydrolase_like_2	5.40e-09	25	213	1	191	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
239947	SGNH_hydrolase_YpmR_like	6.69e-07	31	213	5	204	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid. This subfamily contains sequences similar to Bacillus YpmR.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPC62878.1|CE3	7.73e-167	1	241	1	241
CEI70576.1|CE3	6.83e-148	1	241	1	244
QKD61617.1|CE3	5.06e-111	1	220	536	758
QKD52243.1|CE3	3.46e-85	12	240	16	246
UPK99830.1|CE0	3.55e-85	3	240	4	246

PDB Hits     

FGRAMPH1_01T21541-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9RLB8|CESA_RUMFL	1.79e-10	20	234	38	283	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000462	0.999492	CS pos: 22-23. Pr: 0.9751

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T21541-p1.