CAZyme Information: FGRAMPH1_01T21537-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T21537-p1
• CAZy Family: GH76
• CAZyme Description: GMC oxidoreductase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
655		70437.61	4.8357

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970334:6974516-6976534(-)

Full Sequence      

MRCTSALSLAISLSTCVTAAPESPFISTLLDPLQHVIQSAYAGDGLKVGKLGELGGIPGV
DATYDYVVVGGGTAGNTIGYRLAKAGFSVAIVEAGGFLEIAKPILATAPGGVTAGSGSSL
LDSNPLRDWRFTTTPQTSADDREIHYARGKVLGGSSQLNFLVYHRPTNGTMAKWAEEVGD
DSYQWDQMLPHFQKTATFTPPDNTKRGASIETDYDASAFSSEGGPVQISYANYVPSWAAL
VAKGLNSLGLKSIDGFSSGSLLGYSYTTTAVRPKTVTRSASDDFVKAARDENLKTLKVYT
QSLAKKVLFDDKKKATGVEVSSIGMDYTLKARKEVIVSGGTFQSPQILMVSGVGPKEHLE
AFDIPVVADLPGVGQNLWDHILFGPSFEVQGLEDTLSVAINDPAVFQGALDAYIQQQAGP
LTSNQVELLGWEKVPEKYRSKFSNSTLKDLEAFPEDWPEVEFIPLNVYSEDWSFPILQQP
TDGKKYTSINGALVAPLSRGNITLQSNSTSDAPLINPNFLGDKGDQEVAIALFRRLREVA
KSGPLKDTVLKEVYPGEEHESDEQILAVLRDTLMTVWHAACTCKMGKKEDKMAVLDSKAR
VYGVQGLRVVDASSFPVLIPGHPMGTVYGLAEKIAHEIIKGQESEGAGYEVDIEV

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T21537-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	63	639	1.1e-177	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.35e-95	60	642	4	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.53e-95	63	641	5	533	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.14e-39	496	634	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	6.67e-31	59	648	51	586	Protein HOTHEAD
366272	GMC_oxred_N	3.32e-24	137	380	12	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF88560.1|AA3_2	0.0	1	655	1	655
QPC62877.1|AA3_2	0.0	1	655	1	655
CZS85865.1|AA3_2	0.0	1	655	1	655
QPC80243.1|AA3_2	0.0	1	655	1	655
CEI70575.1|AA3_2	0.0	1	654	1	654

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FIM_B	1.92e-55	62	643	1	566	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
5OC1_A	2.60e-55	64	643	2	565	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
6ZE2_A	1.60e-54	60	647	2	591	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
3Q9T_A	1.52e-53	64	645	7	575	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	2.10e-53	64	645	7	575	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CFL2|PATE_ASPCL	4.97e-159	12	638	10	624	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A075TRK9|PATE_PENEN	1.58e-157	51	638	40	624	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|A0A1U8QYA8|CICC_EMENI	3.30e-155	51	639	23	608	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	5.91e-147	24	641	8	610	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q12062|AFLK_ASPPU	1.25e-145	63	642	74	643	Versicolorin B synthase OS=Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) OX=1403190 GN=aflK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000506	0.999458	CS pos: 19-20. Pr: 0.9704

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T21537-p1.