CAZyme Information: FGRAMPH1_01T21485-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T21485-p1
• CAZy Family: GH76
• CAZyme Description: pectin lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
766	HG970334|CGC48	79828.43	3.9892

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970334:6915014-6917314(+)

Full Sequence      

MRFQASFAALLAAAATASAQSVAGKAYGFAAGVTGGEGEAVTPATAEELAKLLADDTPRV
IYIDKEFDFTGQTKTGPGCDRKSCSASNGGQLYLGDLSCGGEDNVAVSSITYDAAGPEPL
PVGSNKSIIGNGKAVLKGKGLSIKKGSSNVIIQGIEITQLNPGIVWGGDALELKGENDGV
WIDHCKFSKVGRMFIVTHYDGSRLTISNSEFDGVTDTSASCNGNHYWTMMFYGEGDKVTL
DRNHFHDVAGRAPKLGEPGTNGYFHATNNYFQNMKGHAFDAYQGANAIIEGNVFDGVDQP
VTKEAAGVSTLFIPDEAAAAACQSVLGRACEPNSVTSSGDLPVMKGESGLNAVAQNKDNM
ITPVSASEVVALVSGKAGPAGVGSGSAPTSGSGSAETSPIASEAIPESTPESAPSQEAAP
QDDYEQSAPVVAEQDCDDEAVTQAPEPTSVADCDEEPEYSESASAPAVTEAAAGESEADC
DEGSDYESAPVPKEQETSTPVADCDEEPEAESKPEAPKQEQTTVPEADCDESDYDSQYEA
RSVAPRAVENAQADCDEGSDYDTKPVAPKEQESPVAQADCDEEPNYDSEYSSKPVTPKET
ESATKPVAQADCDEEPATPKESAPATKPVATKDTASADCDEESDYDSKPEAPKQTEAATP
VVDCDEEAEPVVKAEPKPTTAQKDCDEEDETVGAAAKDTPSKESASSGSSTVQMYGQCGG
ANFSGSTKCAAGSSCKKVNEYYSQCLSHSRVRRHMHVYVENEATQP

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T21485-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	110	295	1.3e-76	0.983957219251337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	4.80e-44	109	298	3	190	Amb_all domain.
226384	PelB	6.16e-21	28	300	36	279	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	4.50e-20	119	294	29	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.
411414	MSCRAMM_ClfB	1.04e-14	354	658	512	809	MSCRAMM family adhesin clumping factor ClfB. Clumping factor B is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.
411414	MSCRAMM_ClfB	2.15e-12	390	683	534	808	MSCRAMM family adhesin clumping factor ClfB. Clumping factor B is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF87943.1|CBM1|PL1_4	0.0	1	766	1	766
CZS85838.1|CBM1|PL1_4	0.0	1	766	1	766
QPC62859.1|CBM1|PL1_4	0.0	1	766	1	755
QPC80228.1|CBM1|PL1_4	0.0	1	766	1	745
CEI70546.1|CBM1|PL1_4	4.12e-308	1	766	1	611

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	1.84e-67	22	341	3	322	Pectin Lyase B [Aspergillus niger]
1IDK_A	1.29e-60	22	339	3	319	Pectin Lyase A [Aspergillus niger]
1IDJ_A	3.42e-60	22	339	3	319	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
5X39_A	2.55e-08	711	746	1	36	Chain A, Exoglucanase 1 [Trichoderma reesei]
1CBH_A	4.77e-08	711	746	1	36	Chain A, C-TERMINAL DOMAIN OF CELLOBIOHYDROLASE I [Trichoderma reesei],2CBH_A Chain A, C-TERMINAL DOMAIN OF CELLOBIOHYDROLASE I [Trichoderma reesei],2MWJ_A Chain A, Exoglucanase 1 [Trichoderma reesei],2MWK_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X34_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X35_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X36_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X37_A Chain A, Exoglucanase 1 [Trichoderma reesei],5X38_A Chain A, Exoglucanase 1 [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CZD4|PELF2_ASPTN	3.55e-90	15	418	16	401	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|Q0CFF7|PELF1_ASPTN	8.01e-87	5	378	4	384	Probable pectin lyase F-1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-1 PE=3 SV=1
sp|Q5B3J8|PELF_EMENI	1.61e-83	9	394	12	389	Probable pectin lyase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelF PE=3 SV=1
sp|Q8NJK6|PELF_ASPNG	2.34e-82	18	410	20	411	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	2.34e-82	18	410	20	411	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000282	0.999677	CS pos: 19-20. Pr: 0.9764

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T21485-p1.