CAZyme Information: FGRAMPH1_01T21411-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T21411-p1
• CAZy Family: GH76
• CAZyme Description: beta-glucosidase H

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
848	HG970334|CGC40	94075.40	5.4102

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970334:6832430-6835080(-)

Full Sequence      

MGSIDKDYAPSRLPLEDSVSLLSGEDFWRTTPNKALGLGSLKFSDGSNGVRGEDWINGAP
SAAIPCGTALGASFDVELVSRLSNLLARECKRKGVHGLLAPTMNIHRYPLCGRNFESFSE
DPLLSGLIAASFVQGLQAQGIATSPKHFLANEAENGRRWSDSVIQERALREIYLEPFRIV
VQKADPWAIMTAYNSVNGSFCSESKTLLSILRGEWHYNGVVISDWFGTYSTVEAFSAGLD
LEMPGPTKFREQDKVLGLLKRDEIEKRQIRDSASRVLDLLQKTGRIGQPGHPPPSKAEEP
EYLDNLETRTLLRQAAESSMVLLKNEGSTLPLVNRRTKLAVFGRHATEPSLFGGGSASIK
VPYSSTPWDAIQETYHDAALGPGVAIERLVPLPNECGLELGDITLTWYNGDTVSDSARFF
SQQLKDTLYMLVEHAPGGLIDRSNFCTSMKFVFTAQHTGPFHISLSGPGNAQCLVDGEIV
LDVQRGLDISTEDFLFDRSKLEVSRDKPLQLQAGLRYNFEVVNWSSKHKAQNVNREFFIQ
GCRLGLSPARDDDKALIDAERLVETVETSIVVVGTGTEWESEGFDRVSMQLPRRQDELIL
RVAEKCKGRTIVVVNAGSPIDMSGWIDHVDAVVYAWFPGMEFGSALARLLSGEVSPCGRL
PTTFWDKVEDYPAGYVEELMTADRKIQYREGVFVGYRQESLQSYTPRFSFGHGLSYTTFS
CSVKSHTASLVQNSPSFTDRIILTLQNTGSITASETVLLFMEAIDPTTTRPRVELRGFAK
TRLLEPGHSQDLEFILKPRDFAYWDEKAHLWRIDSGSYKVHVAGSRGVGDWRDIEDVIVK
FAEGITIP

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	34	244	2.2e-60	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.52e-65	36	367	58	382	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	1.03e-48	65	807	121	736	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	3.91e-47	320	696	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	8.04e-33	65	279	89	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	1.54e-29	87	798	140	744	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF86475.1|GH3	0.0	1	848	1	848
CZS85801.1|GH3	0.0	1	848	1	848
CEI70473.1|GH3	0.0	1	847	1	847
CCT66579.1|GH3	0.0	1	847	1	845
QGI93649.1|GH3	0.0	1	847	1	860

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.63e-146	1	825	1	824	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.71e-141	2	825	2	824	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	3.59e-106	12	840	11	663	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.18e-86	13	844	12	665	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.63e-84	11	825	9	701	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DPG0|BGLH_NEOFI	9.83e-155	2	825	3	808	Probable beta-glucosidase H OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglH PE=3 SV=1
sp|B0XM94|BGLH_ASPFC	7.63e-154	5	825	6	808	Probable beta-glucosidase H OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglH PE=3 SV=1
sp|Q4WL79|BGLH_ASPFU	4.21e-153	5	825	6	808	Probable beta-glucosidase H OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglH PE=3 SV=1
sp|P27034|BGLS_RHIRD	6.15e-149	12	825	8	798	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|A1DNN8|BGLJ_NEOFI	3.05e-148	1	825	1	843	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999754	0.000264

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T21411-p1.