CAZyme Information: FGRAMPH1_01T21219-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T21219-p1
• CAZy Family: GH67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
973	HG970334|CGC20	108030.50	6.3148

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970334:6623917-6627340(+)

Full Sequence      

MTSEKPASRFIETGVLQPPSPTMDSATLKRLEAGDHGPPSPAAQLPSFMMQQKSPELKRG
PLTRSSHSSYSGTPAVMQIPDATAADLPVVAKYIARRATLLGWFDEPAAAAMTSGWSSTC
IALKKPDGSYLYNPDDPSPDLAAAIGRMNEAAVVSMSSEVTSAVLDTIKPEQACLVNEDT
GARIPIVATLNDIHDSLVHLTSACIVVQERCVLIWSHEARTVLNVAHNVEKQMLGFIVGP
NMPQGLLAQTEEHSVENYHTPVRGAIDENNEVYQAAIKVEEGGDDDDGDIEGKALKRPTL
LIHSFRIGIVMILVILTQSVGVSRLIRQWSWDGDYKRFALAAVIPPLMILSLFFFIVVVS
SVFQLLLPAGICLKNSKFHSAIKPNPKRYKDYQLPHITVQMPVYKEGLRGVIVPTMVSVM
AAIQHYENQGGTASVYINDDGMQCIQPELAAARKQYYRENGIGYCARLPNKKSPKGKGAF
SWFKRSPPVDPEVDNQDESSRSPQGRANALGFERKGKFKKASNMNYCLAFSNRVEDEMLR
LTDLECQNRGCNYEELSAEDDDRLYEQALQNMVDADEGKTWAEGNIRMGEIILLIDCDTR
LPVDCLLYGALEMYESPEVAILQHGSGVMQVAHNIFENGITYFTNVIYTAIKYGVGTGDV
APFVGHNAFLRWKAVQSVAFVDPSDKVTKWWSDAHVSEDFDISLRVQMAGMVCRLATYHN
GGFQEGVSLTIYDELNRWEKYAYGCNELVFHPFYQWIYKGPVTRLFLRFLWSNMPVSSKI
SIIAYIFTYYALAAGLLLTMINYVLVGLFFYDLDQFYMPSWGIWVSLLVVFNGIGTVATS
MTRHRLKEKSFWTAILEAAKWLPFLLLFFGGISINCAKALLCHAFSINIEWASTSKELGP
TGIYIGLNKMMHRFKWTFIICFALSGGMIYMAIGAPWGWTIAPGEFSSGTFAIVPLAVQI
GCAFCLPLFLGLT

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T21219-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	591	805	2.2e-53	0.9644670050761421

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	1.94e-54	591	798	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	1.52e-09	589	872	138	396	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	1.82e-06	589	699	79	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224137	GT2	0.001	581	786	69	281	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SCB65002.1|GT0	0.0	1	973	1	973
QPC62761.1|GT0	0.0	1	973	1	973
QPC80132.1|GT0	0.0	1	973	1	973
CZS85709.1|GT0	0.0	1	973	1	944
CEI70391.1|GT0	0.0	1	973	1	975

PDB Hits     

FGRAMPH1_01T21219-p1 has no PDB hit.

Swiss-Prot Hits     

FGRAMPH1_01T21219-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000062	0.000000

TMHMM  Annotations     

Start	End
304	326
338	360
789	811
820	842
852	874
918	940
950	972