CAZyme Information: FGRAMPH1_01T21111-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T21111-p1
• CAZy Family: GH55
• CAZyme Description: acetylxylan esterase 1 precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
310		34140.72	9.0828

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970334:6498032-6499061(+)

Full Sequence      

MKLSSILSVWVFTLISTVFGAELVPRSTLKEVTGYGNNPTGTRMFLYVPKNLKANPAVVV
GLHYCTGTAQAYYQSNKWASNAEKYGFIVIYPQTPYTPGNCWDVSSKMTLTHEGGGCSTS
VANMVKHVLKNYSGDSKRVFVTGDSSGAMMTNVMAATYPDIFAAAIVYAGVPAGCFMSQA
NQAAAWNSTCSQGQSRYTQQQWANVVKNMYPGYNGPRPKMQIYHGTADPTLNVQNYYEEI
KQWTGVFGYSATPKSTTNNFPRSPYKREVFGDKLETFLGTGVTHAVDHFPDEDLKFFGLV
VRYNPIPATI

Enzyme Prediction     

EC	3.1.1.72:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	42	234	2e-24	0.7665198237885462

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	1.09e-49	44	258	1	209	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
226040	LpqC	5.35e-24	1	286	8	276	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	3.14e-21	46	235	5	187	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
226584	COG4099	2.90e-06	46	186	178	319	Predicted peptidase [General function prediction only].
395257	Peptidase_S9	9.53e-06	125	171	52	98	Prolyl oligopeptidase family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF87325.1|CE1	2.95e-235	1	310	1	310
CZS85651.1|CE1	2.95e-235	1	310	1	310
QPC80084.1|CE1	1.06e-228	1	310	1	310
QPC62711.1|CE1	7.72e-227	1	303	1	303
CEI70326.1|CE1	6.26e-217	1	308	1	308

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	9.23e-111	28	298	3	273	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NBI2|AXE1_ASPFN	3.65e-117	20	298	25	304	Probable acetylxylan esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=axeA PE=3 SV=1
sp|A1CSZ8|AXE1_ASPCL	1.08e-116	21	298	27	305	Probable acetylxylan esterase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=axeA PE=3 SV=1
sp|A9JPE6|AXE1_ASPFL	2.97e-116	20	298	25	304	Probable acetylxylan esterase A OS=Aspergillus flavus OX=5059 GN=axeA PE=3 SV=1
sp|Q75P26|AXE1_ASPOR	2.97e-116	20	298	25	304	Acetylxylan esterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=axeA PE=1 SV=1
sp|Q4WBW4|AXE1_ASPFU	7.18e-115	21	298	26	303	Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=axeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000251	0.999731	CS pos: 20-21. Pr: 0.9821

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T21111-p1.