CAZyme Information: FGRAMPH1_01T21001-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T21001-p1
• CAZy Family: GH5
• CAZyme Description: choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
641		69403.55	4.6590

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970334:6374944-6376869(+)

Full Sequence      

MRQSFLTGLLAAPLSAYAVALTGYEYIVVGSGAGGGPLAARLAMAGHKTLLIEAGDDYAT
TNYTVPAYSANASEDPEISWNFFVKHYADDERQARDFKTTYDTPDGEYTGLNPPADAKLK
GTLYPRTQALGGCTAHNALIAVYPHQSDFEYIATLTGDDSWSAKNMRKYFVKAEDNNHLL
PLQPGHGYDGWLSTETAPLSIPLGDAQLMSLLVGGATALSEVTGELLTMETLIAGDANAD
TLARDQKPGYYQIPLSTKSASRVGPREFILSVRDAKFDNGTKRYPLDVRTNAYVTKVLFD
ESEKTPRATGVEFLDGKHLYSASPLSTGAAGVAGNATASREVIVAGGVYNTPQILKLSGI
GPADELKKFDIPVVVDLPGVGTNLQDHYEISVQGNTPENFTAFDGCTFSLYTDEDPCLDR
WRQPVLGDHGIYSSSGLAATMFYKSTTAEQNNFDIFAFGGPVNFRGYFPKYAVNATIDHD
FFSWAILKAHPRNTAGNVLLRSADPLDTPAITFNYFDTGNGDSDKDLQAMYEAVELARKA
FASQPVKTQETLPGDHVKTQEDVETYIKDNTWGHHASSTCPIGADDDKMAVLDSKFRVRG
VAGLRVVDASVYPRIPGTFTAVSTYMVAEKAADIMLAELEE

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T21001-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	23	637	1.1e-99	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	8.89e-81	24	636	6	532	choline dehydrogenase; Validated
225186	BetA	5.69e-73	24	638	8	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	1.46e-32	496	631	5	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.63e-27	286	618	235	559	Protein HOTHEAD
366272	GMC_oxred_N	1.51e-15	286	389	142	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CZS85597.1|AA3	0.0	1	641	1	641
CEF87088.1|AA3	0.0	1	641	1	641
QPC62677.1|AA3	0.0	1	641	1	641
QPC80051.1|AA3	0.0	1	641	1	641
CEI70340.1|AA3	0.0	1	641	1	641

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS2_AAA	4.70e-41	24	635	8	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YRU_AAA	6.39e-41	24	635	8	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	6.39e-41	24	635	8	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6ZH7_A	6.39e-41	24	635	8	560	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	7.74e-41	24	635	24	576	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8ZGW0|BETA_YERPE	3.99e-54	24	633	3	529	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis OX=632 GN=betA PE=3 SV=1
sp|Q1C932|BETA_YERPA	3.99e-54	24	633	3	529	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) OX=360102 GN=betA PE=3 SV=1
sp|Q1CFR7|BETA_YERPN	3.99e-54	24	633	3	529	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=betA PE=3 SV=1
sp|A7FKL6|BETA_YERP3	1.05e-53	24	633	3	529	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) OX=349747 GN=betA PE=3 SV=1
sp|B1JSR0|BETA_YERPY	1.05e-53	24	633	3	529	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) OX=502800 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.003125	0.996867	CS pos: 18-19. Pr: 0.9689

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T21001-p1.