CAZyme Information: FGRAMPH1_01T19765-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T19765-p1
• CAZy Family: GH47
• CAZyme Description: murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
498	HG970334|CGC1	53759.32	5.3848

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970334:4668368-4669918(+)

Full Sequence      

MKFLTTVIGLASAANAHTLFTTLFIDGENQGDGTCVRQPKDASTANSPIYPIDGAAMACG
RDGGKAVQYICPAPGGAQLTFQFRESPSGHKKGAIAKGHRGPCSVYMKKVDDMFSDSAAG
DGWFKVFEDGYSVKDDKWCVDRLNENKGLLSVNLPTGLPSGYYLVRPEILALHSAPEGDP
QFYQSCAQIFIENGPEGPLEIPEKYETSIPGYVTKKDPAVTFNIYDKHGEYPIHGPDVWN
PTSKETGTKKTQKDGLVPKTCLAKNANWCGKPLAKYSDQDGCWAAAKKCWDEVGDCWDNA
PPTGGYGCDTWNDYCQEINDACKAKDFQGPPAFTGKEHYVDTPGPIPASYGKFKAIAIGM
TKEIKNSNSNPKPVEVDYEPPSYEVPSKTTKAVKAPAATTEVSLPASNTQSTQETATRTW
DEDEKNTLFTDTPVIAPPLPAVTFPVKVSEDGLCGGENGQTCEGSRFGDCCSREGKCGRK
TKQCGCGCQKVFGLCNEK

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA9	5	226	7.7e-55	0.9863636363636363

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
410622	LPMO_AA9	6.20e-71	17	239	1	216	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 9 (AA9). AA9 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs) involved in the cleavage of cellulose chains with oxidation of carbons C1 and/or C4 and C6. Activities include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54) and lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56). The family used to be called GH61 because weak endoglucanase activity had been demonstrated in some family members.
397484	Glyco_hydro_61	2.31e-58	20	231	3	211	Glycosyl hydrolase family 61. Although weak endoglucanase activity has been demonstrated in several members of this family, they lack the clustered conserved catalytic acidic amino acids present in most glycoside hydrolases. Many members of this family lack measurable cellulase activity on their own, but enhance the activity of other cellulolytic enzymes. They are therefore unlikely to be true glycoside hydrolases. The subsrate-binding surface of this family is a flat Ig-like fold.
211316	ChtBD1_1	1.62e-11	454	496	2	44	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CZS84980.1|AA9|CBM18	0.0	1	498	1	498
CEF85876.1|AA9|CBM18	0.0	1	498	1	498
QPC62143.1|AA9|CBM18	0.0	1	498	1	498
QPC79548.1|AA9|CBM18	0.0	1	498	1	498
CEI69745.1|AA9|CBM18	0.0	1	498	1	503

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NLT_A	4.83e-29	18	240	2	223	Chain A, CvAA9A [Achaetomiella virescens],5NLT_B Chain B, CvAA9A [Achaetomiella virescens],5NLT_C Chain C, CvAA9A [Achaetomiella virescens],5NLT_D Chain D, CvAA9A [Achaetomiella virescens],5NLT_E Chain E, CvAA9A [Achaetomiella virescens],5NLT_F Chain F, CvAA9A [Achaetomiella virescens],6YDC_A Chain A, LPMO lytic polysaccharide monooxygenase [Achaetomiella virescens],6YDC_B Chain B, LPMO lytic polysaccharide monooxygenase [Achaetomiella virescens],6YDC_C Chain C, LPMO lytic polysaccharide monooxygenase [Achaetomiella virescens],6YDC_D Chain D, LPMO lytic polysaccharide monooxygenase [Achaetomiella virescens],6YDD_A Chain A, LPMO lytic polysaccharide monooxygenase [Achaetomiella virescens],6YDD_B Chain B, LPMO lytic polysaccharide monooxygenase [Achaetomiella virescens],6YDE_A Chain A, LPMO lytic polysaccharide monooxygenase [Achaetomiella virescens],6YDF_A Chain A, LPMO lytic polysaccharide monooxygenase [Achaetomiella virescens],6YDF_B Chain B, LPMO lytic polysaccharide monooxygenase [Achaetomiella virescens]
5TKF_A	1.64e-28	17	239	1	221	Neurospora crassa polysaccharide monooxygenase 2 high mannosylation [Neurospora crassa],5TKF_B Neurospora crassa polysaccharide monooxygenase 2 high mannosylation [Neurospora crassa],5TKF_C Neurospora crassa polysaccharide monooxygenase 2 high mannosylation [Neurospora crassa],5TKF_D Neurospora crassa polysaccharide monooxygenase 2 high mannosylation [Neurospora crassa],5TKG_A Neurospora crassa polysaccharide monooxygenase 2 resting state [Neurospora crassa],5TKG_B Neurospora crassa polysaccharide monooxygenase 2 resting state [Neurospora crassa],5TKH_A Neurospora crassa polysaccharide monooxygenase 2 ascorbate treated [Neurospora crassa],5TKH_B Neurospora crassa polysaccharide monooxygenase 2 ascorbate treated [Neurospora crassa],5TKI_B Neurospora crassa polysaccharide monooxygenase 2 resting state joint X-ray/neutron refinement [Neurospora crassa]
5TKI_A	1.53e-27	17	239	1	221	Neurospora crassa polysaccharide monooxygenase 2 resting state joint X-ray/neutron refinement [Neurospora crassa]
5FOH_A	2.89e-27	17	225	1	204	Crystal structure of the catalytic domain of NcLPMO9A [Neurospora crassa OR74A]
4EIR_A	3.97e-27	18	239	2	221	Structural basis for substrate targeting and catalysis by fungal polysaccharide monooxygenases (PMO-2) [Neurospora crassa OR74A],4EIR_B Structural basis for substrate targeting and catalysis by fungal polysaccharide monooxygenases (PMO-2) [Neurospora crassa OR74A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2R5N0|EGLD_ASPNC	2.80e-41	7	243	8	239	Probable endo-beta-1,4-glucanase D OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=eglD PE=3 SV=1
sp|Q96WQ9|EGLD_ASPKW	9.51e-41	7	243	8	239	Probable endo-beta-1,4-glucanase D OS=Aspergillus kawachii (strain NBRC 4308) OX=1033177 GN=eglD PE=3 SV=1
sp|A1C4H2|EGLD_ASPCL	5.53e-39	1	243	1	236	Probable endo-beta-1,4-glucanase D OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=eglD PE=3 SV=1
sp|Q0CEU4|EGLD_ASPTN	1.71e-38	7	243	7	236	Probable endo-beta-1,4-glucanase D OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=eglD PE=3 SV=1
sp|Q5BCX8|EGLD_EMENI	3.98e-36	1	243	1	235	Endo-beta-1,4-glucanase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=eglD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000314	0.999649	CS pos: 16-17. Pr: 0.9693

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T19765-p1.