CAZyme Information: FGRAMPH1_01T18721-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T18721-p1
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
492	HG970334|CGC2	55579.45	6.6452

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970334:3331459-3332937(+)

Full Sequence      

MVSRNRSGRRRTAALAFFVATVILLNYKGFLTLPSFEAAKPDRPELSLAPTCAPTIDHLR
RSAYGLTRDVVYQKRCVRPVMDKKIDTQIVSQNPDTLIKDSQIVQLDQACEGWTEPACEP
VTLKVPPPYPQEDYSPFLFGVATSLDRLNESLSQFESWLGNTHAQLLAVITDPGDEHKYE
AVTKEFHRRGVEVTIKDPWNKAITSNEQHFAIVRDLLQHVTPKTRWVAIVDDDTFFPSLY
PMSQILAKNDHKVPAYIGGLSENYDAVKHHGYMAFGGAGVFLTPALLRELDPHLEECLKN
EHVPQGDGLLKQCIYSKTKTKLTVVKGLHQLDMGGDMSGFYESGRLPMSLHHWKSWHQAP
VDKMVKISEFCGSCFLQRFAFGSDTVLTNGYSIVQYSAGLESVDLNKMEGSWEGAQGFDW
SMSPMRSKMDRRLKKSYHLVDTEVIGKNIRQIYIHRVEEDIPGPGEKSGDPKNPGPKIEE
MKDEVIELLWEL

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T18721-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	3.38e-11	222	352	209	341	hypothetical protein; Provisional
398362	DUF604	6.25e-06	269	352	4	90	Protein of unknown function, DUF604. This family includes a conserved region found in several uncharacterized plant proteins.
367085	Fringe	2.56e-05	222	356	83	231	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CZS84460.1|GT31	0.0	1	492	1	492
CEF86898.1|GT31	0.0	1	492	1	492
QPC61769.1|GT31	0.0	1	492	1	492
QPC79112.1|GT31	0.0	1	492	1	492
CEI69250.1|GT31	0.0	1	492	1	492

PDB Hits     

FGRAMPH1_01T18721-p1 has no PDB hit.

Swiss-Prot Hits     

FGRAMPH1_01T18721-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.991560	0.008482

TMHMM  Annotations     

Start	End
13	35