CAZyme Information: FGRAMPH1_01T18539-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T18539-p1
• CAZy Family: GH43
• CAZyme Description: trehalose 6-phosphate synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
933	HG970334|CGC33	104819.87	6.5991

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970334:3125017-3127964(-)

Full Sequence      

MTVFVCSLFLPKTIHFTLPGTPPPGVDPSRTSLSGSSNINLRGDTRASLSGSAVPKDGAA
LPPKTAAPVGGRPAPLNRQPSLFQKEDITPPRTPTEEVDVNLFANEDGIRIPFPKRPGSN
AGSGKPWGSRANQPKSRASSPPPPALSENSRTMQKARELGRQGVIQPKPLVRSDSHDRVF
ASAGWMVVNADQGNGGLRNAADAAARDGKIDEITWVGTLGMPTDALEGTEQKQDIENTLA
NEHNMLTVFCSDKDFDGHYAHFCKHILWPVFHYQIPDNPKSKAYEDHSWKYYVNVNQAFA
DQIVKNWKRGDVVWIHDYHLLLVPEMVRKKIPEAKIGFFLHVAFPSSEVFRCLAVRKELL
EGMLGANLVGFQIHEYGRHFLQTCSRILNAEATPDGLQLEDRFVDVIHLAIGIDPVSLRE
HLDAPEVAKWLQIMQERYKGKRLIVARDKLDHVRGVRQKLLSYELFLNKNPQWRENTVLI
QVALSSSEKSDLEATVSDIVTRVNSSWANLAYQPVVYLKQDIDYAQYLALLTIADALMIT
SQREGMNLTSHEYLFCQDGKLLPEKKHGSLILSEFTGTSSLFAKNELAVNPWDYRACADA
IKQALEMGQDEKDQRWNNLYGRVVKHTGSHWFTEFLGRLDIVYEEQHKRDQTSVPRLSVP
ALSSKYTKAERRLFIIDYEGTLVAWGPVNQIIPISPQRTLDVLNDLLLDERNTVYVMSGR
RPEELDRVFRRVPNLGLIAENGCFLKSHGDDSWTEMADLDHVKDWKESVRPIMTYFLERT
PGAEIEERRCSLIFHYKSAEDYETASRQASDCASHVNDACESQRVHAIALDGCIAVEPID
WTKRTAARKVFETLKEEIHPTTEKKAPVDFLMVIGDGREDEKVFKWANRLQDDGSVENVV
TVSLGNRNTEATATLTQGVSGVLSCLQRLASLE

Enzyme Prediction     

EC	2.4.1.15:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	188	639	6.2e-157	0.9263157894736842

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340820	GT20_TPS	0.0	187	639	20	462	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	0.0	211	639	44	468	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
184712	PRK14501	2.39e-168	214	931	44	725	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
223457	OtsA	2.21e-163	213	652	62	486	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
215555	PLN03063	5.03e-130	209	884	49	717	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF86903.1|GT20	0.0	1	933	1	933
CZS84370.1|GT20	0.0	1	933	1	933
QPC79043.1|GT20	0.0	1	933	1	933
QPC61696.1|GT20	0.0	1	920	1	920
CEI69165.1|GT20	0.0	1	933	1	933

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JBI_A	3.98e-102	194	640	27	463	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5DXF_A	2.58e-96	164	636	36	520	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
5HUT_A	2.01e-95	209	650	43	478	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HUV_A	2.80e-95	209	650	43	478	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HVM_A	3.09e-94	194	665	39	500	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UUI7|TPSY_SCHPO	1.32e-199	81	931	58	891	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 100 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC22F8.05 PE=1 SV=1
sp|O14081|TPSX_SCHPO	3.25e-199	90	931	97	943	Putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 106 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E11.16c PE=1 SV=1
sp|P38426|TPS3_YEAST	2.05e-161	179	827	308	929	Trehalose synthase complex regulatory subunit TPS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS3 PE=1 SV=3
sp|P38427|TSL1_YEAST	6.12e-161	175	839	336	976	Trehalose synthase complex regulatory subunit TSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TSL1 PE=1 SV=1
sp|Q54K57|TPSA_DICDI	3.06e-130	204	818	48	645	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999280	0.000747

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T18539-p1.