CAZyme Information: FGRAMPH1_01T18357-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T18357-p1
• CAZy Family: GH43
• CAZyme Description: glycosyltransferase family 17

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376		44009.21	8.6344

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970334:2887370-2888500(+)

Full Sequence      

MTSLVPSRPFVLLLFLVCVAALLSRQPYFDRSHAHRITYADIRATQILPRLNFSRSHHEF
YASEAARSLCDAHGYSVFKPRSDALDGRRKIYDLFMVNTELDFLEIRLKTLYNYIDYFVI
VEAPLTFQGGPKNLTIHDNWKRFEAYHDKMIYHQLQYPKGFKPLRHWDREDLQRNAMFEQ
VFPKLTGEQTPARGDVILVADVDEVPRPATMLVLRTCNFPRRLTLSSKFYYYSFQFLHDG
PEWPFPQATYYQGMRKTILPGNLRTGDAGIPLLRDLEKGVLSNAGWHCSSCFATVDQFLN
KMASFSHAWMNRDSFRDRDRIANAVRQGVDLWGRKVDTFTRVDNNLDLPRCLLEDRERFR
YILDRDGETAGFTDYP

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T18357-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT17	67	364	7.1e-82	0.9859154929577465

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398414	Glyco_transf_17	6.04e-52	6	363	3	342	Glycosyltransferase family 17. This family represents beta-1,4-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase (EC:2.4.1.144). This enzyme transfers the bisecting GlcNAc to the core mannose of complex N-glycans. The addition of this residue is regulated during development and has functional consequences for receptor signalling, cell adhesion, and tumor progression.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF88474.1|GT17	9.55e-288	1	376	1	376
CZS84279.1|GT17	1.36e-287	1	376	1	376
QPC61621.1|GT17	1.03e-282	1	376	1	376
QPC78966.1|GT17	4.68e-279	1	376	1	376
CEI68537.1|GT17	1.24e-258	1	376	1	376

PDB Hits     

FGRAMPH1_01T18357-p1 has no PDB hit.

Swiss-Prot Hits     

FGRAMPH1_01T18357-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.207125	0.792856	CS pos: 25-26. Pr: 0.4514

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T18357-p1.