CAZyme Information: FGRAMPH1_01T17823-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T17823-p1
• CAZy Family: GH36
• CAZyme Description: glycoside hydrolase family 16 partial

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
347		37932.87	4.3576

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970334:2152905-2153997(+)

Full Sequence      

MIASLCALVTAVHLVSGTCDCGYSIQSPEDEGVIVFMDRLETDFGQLQNISQSHDWVAQE
FTVSAEDGRGNYSKAFEPTNVAIQATHAQNNPSQGNGVELRVSSTINNDAIPGSEIDTTR
LDLHWGSFRAGIKLTDVKGTCAAFFWYFNDTQEIDIEFLSQEFDHGRGVYPANLVVQSRA
SMEAGYDASKTGNFKRVDLDFDPTESFHEYRFDYIPGHVLFYADSKLLAQMNGSDMPTSG
GHLILQHWSNGNPLWSGGPPTKDATITVSYVKAYFNSSDPKRQTYLQQQCGLSTERASVC
TIQNVTNATSHSGDMPHDSDDNDQSDAAVAELSLLGGLGLGLLVLFL

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T17823-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	86	274	4.7e-92	0.9791666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	5.48e-40	68	274	19	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	9.39e-11	124	270	67	205	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
395585	Glyco_hydro_16	4.83e-07	113	272	22	168	Glycosyl hydrolases family 16.
225182	BglS	2.42e-05	119	314	112	296	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
178706	PLN03161	3.91e-04	95	225	44	161	Probable xyloglucan endotransglucosylase/hydrolase protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CZS84016.1|GH16_23	6.16e-258	1	347	1	347
CEF86553.1|GH16_23	6.16e-258	1	347	1	347
QPC61390.1|GH16_23	3.28e-253	1	347	1	347
QPC78742.1|GH16_23	1.82e-250	1	347	1	347
CEI68761.1|GH16_23	1.43e-215	1	347	1	347

PDB Hits     

FGRAMPH1_01T17823-p1 has no PDB hit.

Swiss-Prot Hits     

FGRAMPH1_01T17823-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000308	0.999686	CS pos: 17-18. Pr: 0.9726

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T17823-p1.