CAZyme Information: FGRAMPH1_01T17755-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T17755-p1
• CAZy Family: GH36
• CAZyme Description: choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
543		60071.34	7.0630

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970334:2063947-2065578(-)

Full Sequence      

MTTEFLPASASSAYDYIIVGGGTAGCVLASRLSAYLPERKVLVIEGGPSDFGLNNVLNLR
EWLSLLGGDLDYDYPTTEQPNGNSHIRHSRAKVLGGCSSHNTLISFRPFRHDMDRWVAKG
CKGWDFETVMRSVDNLRNQLNPVHPRHRNQLTKDWVKACSEAMGIPIIHDFNHEISEKGQ
LTQGAGFFSVSYNPDTGHRSSASVAYIHPILRGDERRPNLTVLTEAHVSKVLVENDVATG
INITLKSGEKHTLHARKETILCAGAVDTPRLLLHSGIGPKAQLESLNIPVVKDIPGVGEN
LLDHPETIIMWELNKAVPANQTTMDSDAGIFLRREPKNAAGNDGDAADVMMHCYQIPFHL
NTERLGYPKIKDGYAFCMTPNIPRPRSRGRIYLTSADPTVKPALDFRYFTDPEGYDAATL
VHGIKAARKIAQQSPFKEWLKQEVAPGPKIETDEEISEYARRVAHTVYHPAGTTKMGDTE
RDEMAVVNPELKVRGINKLRIVDAGIFPEMPTINPMVTVLACGERAAELIAAEDGWKPKH
SRL

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T17755-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	13	532	1.9e-144	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	4.15e-118	14	535	8	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	7.30e-115	9	530	1	531	choline dehydrogenase; Validated
274888	Rv0697	1.71e-67	15	531	2	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
398739	GMC_oxred_C	8.78e-43	385	526	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.87e-41	1	523	43	569	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CZS83982.1|AA3_2	0.0	1	543	1	543
QPC78713.1|AA3_2	0.0	1	543	1	543
QPC61362.1|AA3_2	0.0	1	543	1	543
CEF86690.1|AA3_2	0.0	1	543	1	543
CEI68793.1|AA3_2	0.0	1	543	1	543

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBV_A	1.05e-132	14	530	14	526	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	1.48e-132	14	530	14	526	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	4.18e-132	14	530	14	526	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
7AV4_AAA	2.33e-64	10	533	80	639	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	2.86e-64	10	533	4	563	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7X2H8|CHOX_ARTGO	5.39e-132	14	530	14	526	Choline oxidase OS=Arthrobacter globiformis OX=1665 GN=codA PE=1 SV=1
sp|Q988C9|4PADH_RHILO	2.66e-78	11	532	4	535	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q00593|ALKJ_PSEOL	5.70e-77	14	530	2	527	Alcohol dehydrogenase [acceptor] OS=Pseudomonas oleovorans OX=301 GN=alkJ PE=1 SV=1
sp|Q9WWW2|ALKJ_PSEPU	6.91e-77	14	530	2	527	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q6LGH5|BETA_PHOPR	1.13e-74	11	541	2	541	Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum (strain SS9) OX=298386 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000012	0.000025

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T17755-p1.