CAZyme Information: FGRAMPH1_01T16515-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T16515-p1
• CAZy Family: GH31
• CAZyme Description: pectate lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
231		24590.78	7.9879

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970334:496502-497301(+)

Full Sequence      

MHFSTFATILAAVPAALACKGYTGGLPKHTGTKTLSTPQYIARGQTFDAGWVKYDRGVKC
TGQSEGGEKDTVFVLEEGAKLRNVIIGANQKEGVYCKGSCTLEFVWFEDVCEDAISIKGG
GTANIIGGGAYKAADKIIQHNGCGHVNIINFYANDYGKVYRSCGNCSGNCRRSVHMEGTT
AVNGGELMGINLNYGDKATYSNNCFPKVQCQGYNGCDKKNGACEPQKVGTC

Enzyme Prediction     

EC	4.2.2.2:5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	30	215	3.5e-80	0.9896907216494846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	2.25e-117	23	220	1	200	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF86969.1|PL3_2	1.53e-177	1	231	1	231
ABT35769.1|PL3_2	1.53e-177	1	231	1	231
CZS83373.1|PL3_2	8.83e-177	1	231	1	231
QPC78206.1|PL3_2	3.60e-176	1	231	1	231
CEI68085.1|PL3_2	7.22e-167	1	231	1	231

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	3.97e-29	41	164	11	135	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	8.75e-22	29	165	3	139	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	8.95e-22	29	165	4	140	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]
4Z03_A	7.99e-21	29	165	12	148	C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725],4Z03_B C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725]
4Z05_A	7.99e-21	29	165	12	148	C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725],4Z05_B C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0Y953|PLYF_ASPFC	1.33e-96	3	231	2	232	Probable pectate lyase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyF PE=3 SV=1
sp|Q5B024|PLYF_EMENI	3.68e-96	13	231	12	231	Probable pectate lyase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyF PE=3 SV=2
sp|Q4WKV8|PLYF_ASPFU	4.41e-95	3	231	2	232	Probable pectate lyase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyF PE=3 SV=1
sp|A1D5E3|PLYF_NEOFI	8.89e-95	3	231	2	232	Probable pectate lyase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyF PE=3 SV=1
sp|B8NJZ7|PLYF_ASPFN	2.07e-93	3	231	2	232	Probable pectate lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.007131	0.992829	CS pos: 18-19. Pr: 0.9415

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T16515-p1.