CAZyme Information: FGRAMPH1_01T16213-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T16213-p1
• CAZy Family: GH3
• CAZyme Description: alpha-l-rhamnosidase c

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
795	HG970334|CGC26	86323.79	5.9248

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970334:179513-181958(-)

Full Sequence      

MMRPYIAIGLLLQTTLAVSEAANVIYASDSCVNLSSDGSRPNIVVLDYGHSVEGHPTFQV
VSASGDTSGFEVTFAESKAALNLYMSDGPLPLAAAMDTYRVNKYNVTEPGLITNRLIQGA
FRYEKFNLSSAGSLRLERVGVKPTVETTPLTELPGSFECSDDDLTRIWYTGARTAQLTEI
PKGSIPDFWQVTDQGSLVESAAPQALSDPGVSQATSYDIEFDAKPITGEFVFSVLSDTLN
EAVLITCNIETGVISTSTSSSGKISSKTNVGEWLSVHARVNMTDIEVSINNQTALKFTQT
SRFYGSFGLGAPLGHSAYYRNLRATTLEGVEIYSSTLKDKSFLKDFFMGNNPLDTIVDGS
RRDRIAYSGDLDIAISSTFASTYGKSFVEGSLDLVGSYQTTAGFWIPNAKIQQEPLPQPL
DINITGLIGYSFNFLNGLATNYEVLGDKTFAKTWAPRAVAMLDWAHSKLVDGLFTIDDAA
LTGDWNYYDPSQTGASTKFNALYAYSLQRTETFLKAGGVSTAKYQTRLKNLRKAIHKQLW
NETMGAYVLSNEVRTGFAQDANALAILSGIPQSNGISSKSLLKTMEAELQLPAGPLAFSN
GTVSSGFAQKISPFSSAYHLRSAFEASDGDTAKQLLKTLWAPMANPSNVNYTNTFWETLD
PNGTPGLGIMTSLCHGWAAAPTAELVKWVLGVQVVKPGFAEWKVQPMLLGLEWAKGRVPT
EKGVIEVEWKLVSDLLHMNVRVVGDKGTRGTIYVPEVLPVSAKDSIFTVNGKIVKKKNQF
SVKGGELVTLIQKRK

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T16213-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	350	753	7.7e-68	0.7361111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
379972	Bac_rhamnosid_C	2.88e-09	691	755	1	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
407469	Bac_rhamnosid6H	7.23e-09	442	681	111	332	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF86884.1|GH78	0.0	1	795	1	795
CZS83239.1|GH78	0.0	1	795	1	795
QPC60789.1|GH78	0.0	2	795	1	793
QPC78119.1|GH78	0.0	2	795	1	793
CEI67897.1|GH78	0.0	2	795	1	795

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	9.11e-14	357	727	331	674	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P9WF03|RHA78_ALTSL	1.05e-06	330	742	466	868	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000223	0.999759	CS pos: 21-22. Pr: 0.8916

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T16213-p1.