CAZyme Information: FGRAMPH1_01T16131-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T16131-p1
• CAZy Family: GH3
• CAZyme Description: beta-glucosidase I

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
820	HG970334|CGC31	89955.17	5.1476

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970334:80578-83141(+)

Full Sequence      

MDTQAVLQSLTLEEKVSLLSGTPDDFTSIAGIPRKNIPPLQTADSISGIRPTEFDSSLTT
ACFPNTACIASTWNIELLKEMGHELTSQAKLKNAQIILGPTINIQRDPRAGRNFECFSED
PLLSGYMAAAIVNGIQSQGFAACAKHFVCNDSETQRRYYNVDETSHGRTLREIYLAAWSF
LLQRSNPAGVMTAYNKVNGTFCCDSKDLIHDVLRGEWDYKGIVMSDWFGTRSTVESMMAG
VDVEMPVPIFRGQKLITAIKNGDVSQDCIDASVSRLLDLRNRTKGAQSVTSMTSEIIPST
NNVALRLAHEGIVLLKNENKALPLQSLHDLKVAVVGEYAKKAVFTGGGSASCNPQYRQVP
LDLLREAFPRTESVSYASGVRMRRIIPIVSPEIITTDQGQKGVEVSFFNAGCDHPFLTET
LEEATVNLMTRTKPGLVLAGSHIKMTGNLVPKTTGTHILALRHSGSFTVEVDGITIFTGD
APDITTEQFLFNLRKLESRIEVPMEAGKTYRISVNMNSRKLVVGEPTPYGLTLAFEEEYH
EIQAIQEAVDVAKSSDITIIYAGRSEQYESEGFDLEEITLPDNQVAMIKEVAAASRKTVV
LLHCGNPIDIDSFVGDVDAVVNMHFPGQEGPQAMVDILTGKVNPSGRLTATWFKTLQDWP
SFGNFPAEKDGNGSFVIKYAEGLAIGYRAPVPAAQIQFPFGHGLSYTSFSYANLTINLDK
SSMASVLKVSVSVTNIGSVFGKDVVQVYISPPERTVDWRPSRELKEFTKISLYPGETKNI
SIDLDVTTFNSYWCESSRAWVVDGGEYGVEVGNQRIAFVI

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T16131-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	30	246	7.1e-58	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.38e-53	7	812	42	751	beta-glucosidase BglX.
224389	BglX	7.57e-53	25	352	48	374	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	5.60e-48	4	785	54	743	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	9.43e-45	545	706	81	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	4.29e-38	34	279	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF85991.1|GH3	0.0	1	820	1	820
CZS83194.1|GH3	0.0	1	820	1	820
QPC60756.1|GH3	0.0	1	820	1	820
QKD60029.1|GH3	0.0	1	820	1	820
CCT73941.1|GH3	0.0	1	820	1	811

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.74e-128	2	813	5	823	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	6.47e-125	2	813	5	823	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.01e-112	1	820	3	662	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	8.29e-108	2	813	4	650	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	3.06e-97	6	812	7	699	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	1.85e-158	4	813	12	825	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|P27034|BGLS_RHIRD	5.92e-144	6	816	5	800	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	7.25e-144	2	811	5	815	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	4.09e-143	1	811	4	816	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|Q4WU49|BGLI_ASPFU	5.59e-143	1	811	4	815	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999457	0.000561

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T16131-p1.