CAZyme Information: FGRAMPH1_01T15975-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T15975-p1
• CAZy Family: GH3
• CAZyme Description: acetylxylan esterase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
276	HG970333|CGC53	28329.92	8.1645

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:8872369-8874597(-)

Full Sequence      

MWNAAFLASLFLIPLATGAPAIRIEERQAPCQNVHIFLARGTDEPYPGRQSSVVSAICSG
LPSCDYENINYPAGFNTYCSSIYAGITGGLSQITTYANRCPNSKIVLSGYSQGAQLFGDI
LGGGGGQSLGCTQPSNPALNPANSPGNKIAAALFFGDPRYVANQAYNTGTGASRSGSTSK
MVNALSMITALAAIAGVQAACPKTCSVGTASGSTCTYTCTRACASLAAGDARDSFLGALQ
ARGYSCSGTGLTGVSCKKTANFGSCYDHYWLCGKNC

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T15975-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	30	178	6.8e-29	0.7671957671957672

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	3.30e-16	30	163	1	122	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SCB66005.1|CE5	2.34e-199	1	276	1	276
CZS83092.1|CE5	9.74e-127	1	176	1	176
QPC60696.1|CE5	4.37e-123	1	176	1	176
QGI94864.1|CE5	1.14e-109	1	176	1	176
QGI63982.1|CE5	6.09e-109	1	176	1	176

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1BS9_A	3.90e-24	31	173	2	149	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
1G66_A	3.90e-24	31	173	2	149	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
2AXE_A	3.90e-24	31	173	2	149	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
1QOZ_A	5.95e-20	31	170	2	146	Chain A, ACETYL XYLAN ESTERASE [Trichoderma reesei],1QOZ_B Chain B, ACETYL XYLAN ESTERASE [Trichoderma reesei]
4PSC_A	4.97e-09	25	160	73	196	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O59893|AXE2_TALPU	4.78e-25	1	173	1	176	Acetylxylan esterase 2 OS=Talaromyces purpureogenus OX=1266744 GN=axe-2 PE=1 SV=1
sp|Q99034|AXE1_HYPJE	2.33e-20	15	170	17	177	Acetylxylan esterase OS=Hypocrea jecorina OX=51453 GN=axe1 PE=1 SV=1
sp|A0A2J8C362|CUTI1_VERDA	7.36e-19	8	170	4	169	Cutinase 11 OS=Verticillium dahliae OX=27337 GN=VD0003_g7577 PE=1 SV=1
sp|B9U443|CUTI1_COPCI	3.14e-13	16	116	16	121	Cutinase CUT1 OS=Coprinopsis cinerea OX=5346 GN=CUT1 PE=1 SV=1
sp|O06319|CULP4_MYCTU	1.68e-09	4	158	26	168	Phospholipase Culp4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cut4 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000237	0.999742	CS pos: 18-19. Pr: 0.9808

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T15975-p1.