CAZyme Information: FGRAMPH1_01T15949-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T15949-p1
• CAZy Family: GH3
• CAZyme Description: UDP-glucose,sterol transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
856	HG970333|CGC52	92802.23	7.6566

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:8842106-8844954(+)

Full Sequence      

MHNNDKPLPKPPAPRHPSFIAPYEAVPGNDAKPDEAPPQYTEEHATTEQILNDIAGATAD
GRIDLNLDSKLCRTLSLLIDRNGPKQRNSDRPLSITPPAYTDQTECHICLNIVIQVVGSR
GDVQPFVALGNELQRHGHRVRLATHDTFADFVLESGLEFYPIGGDPTELMAYMVKNPGLI
PSIKSLRAGDIQKKRLMIAEMLEGCWRSCKEPDPLNQQPFVADAIIANPPSFAHVHCAQA
LGIPLHLMFTMPWSGTKYFCHPLANINANNSGISTAVANQISFMAVEWMTWQGLGDIINT
WRQSLDLEDIPFSEGAGLLETLQIPFTYCWSPALVPKPLDWPDYIDVCGFFFRDIPQYTP
EPGLGAFLRNGPAPIYIGFGSIVIDDADKLTAILVDAVKETGVRAIISKGWSKLGANQPA
DSDIYYLGDCPHEWLFQQVTAVIHHGGAGTTACGLLNGKPTAIVPFFGDQPFWGTMVHAA
GAGPMPIPQKMLDSQNLSHAIRYCLTPGALAAARGMAEKMRQENGVRQAVNSFHANLPLD
KMRCDIIPGLPAAWSYKMGSQHLKLSKAAVEILTDSGRVKWVDLKGYESQPIDIQRRRWD
PLTAVISSGFKMYAGMVTSAADIVIKPAQVLMADRPNTGDPNSVGNSNTQALEDPIYGRC
AGLDVPSGNQNMRNHKSRAGAAFAGSAGAFGDVFKTLTKGFYLDIPHALEEGMRVAPRLY
GGEVYDPGPVTGWKSGGIAAGKNFSHGILEGVGGLVMSPVRGAKKDGTVGAAKGLGIGVL
NLTTKVTSGTLGLLTFTSQGAYKSLRASMRRDTRRTIKQSKQAEGVAILREGKQRVDVGA
VLRIFDHQVAQKPERK

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	135	530	7.9e-50	0.9554973821989529

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	1.26e-78	110	535	1	403	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	1.37e-41	112	535	4	397	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	1.67e-24	112	259	1	138	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	6.98e-08	121	529	7	382	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
227376	MRS6	4.55e-06	737	815	2344	2423	Vacuolar protein sorting-associated protein [Intracellular trafficking and secretion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF79773.1|GT1	0.0	1	856	1	856
CZS83078.1|GT1	0.0	1	856	1	856
QPC60681.1|GT1	0.0	1	856	1	856
QKD56929.1|GT1	0.0	29	825	20	816
QKD57886.1|GT1	0.0	29	825	20	816

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	2.69e-74	98	537	8	439	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	4.53e-74	98	537	28	459	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	8.45e-30	110	523	1	385	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	3.67e-27	110	542	1	393	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	8.04e-20	110	517	1	380	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Z7|U80A2_ARATH	2.80e-123	49	548	138	622	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q9XIG1|U80B1_ARATH	5.11e-120	110	538	156	575	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q6C8M8|ATG26_YARLI	8.11e-75	94	537	983	1413	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3
sp|Q54IL5|UGT52_DICDI	2.50e-74	92	538	1141	1610	UDP-sugar-dependent glycosyltransferase 52 OS=Dictyostelium discoideum OX=44689 GN=ugt52 PE=2 SV=1
sp|Q8NJS1|ATG26_LEPMC	8.79e-74	51	537	925	1374	Sterol 3-beta-glucosyltransferase OS=Leptosphaeria maculans OX=5022 GN=ATG26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000001

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T15949-p1.