CAZyme Information: FGRAMPH1_01T15893-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T15893-p1
• CAZy Family: GH3
• CAZyme Description: rhamnogalacturonase A precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
446	HG970333|CGC15	47936.76	6.0743

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:8765660-8767148(+)

Full Sequence      

MRHSFVSILVVIGAAVQAAAQLNGKVGPLTPRQAKAAIKTCNITDYGAKANAKTDNSAAI
QKAWDDCKTTGGEVVIPAGDYGLGTWLTLSSKTPMSFRLDGIIYRIGTGDGNMFMFKHLE
DFEFYSSTSQGAIQGYGYEFHKNNKYGPRILRFFDVKSFSMHDVALVDSPAFHFSLDTCS
DGEVYNTVIHGGARGGLDGIDVWGSNIHIHDVEVSNKDECVTVKNPSDHLLIENIFCNWS
GGCAMGSLATDTNIHDIEYKNVYTQGSNQMYMFKSYGGSGTVSNIALKKFRGHSNAYTLN
VDAEWSSMKPVAGDGILYSNMTFSEWSGSCTDGRQRGPIKFNCPADVPCVDLQVDDFTVG
SSKGNVVEHICKNAYGSGVCLKEGDGGAYTATQTVNNPNFATQTMGGELTAGLGLTASIA
IPTIRSSFFPGTPVINSLMSNSAKED

Enzyme Prediction     

EC	3.2.1.171:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	66	375	5.1e-47	0.9661538461538461

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
177865	PLN02218	3.64e-20	32	374	59	418	polygalacturonase ADPG
215426	PLN02793	1.24e-17	31	379	38	414	Probable polygalacturonase
178580	PLN03003	1.99e-15	42	376	25	377	Probable polygalacturonase At3g15720
215540	PLN03010	1.32e-14	42	376	48	391	polygalacturonase
215120	PLN02188	1.57e-14	5	374	8	390	polygalacturonase/glycoside hydrolase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF79745.1|GH28	0.0	1	446	1	446
CZS83044.1|GH28	0.0	1	446	1	446
CEI63616.1|GH28	0.0	1	445	1	445
QGI94855.1|GH28	2.62e-281	1	444	1	444
QGI63973.1|GH28	2.62e-281	1	444	1	444

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RMG_A	7.88e-168	21	438	1	420	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]
4C2L_A	3.71e-15	48	373	23	373	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NK45|RHGA_ASPFN	1.08e-175	3	438	2	440	Probable rhamnogalacturonase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=rhgA PE=3 SV=1
sp|Q2U293|RHGA_ASPOR	3.08e-175	3	438	2	440	Probable rhamnogalacturonase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rhgA PE=3 SV=1
sp|Q5ARE6|RHGA_EMENI	1.98e-173	5	442	2	442	Rhamnogalacturonase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=rhgA PE=2 SV=2
sp|A2QYE5|RHGA_ASPNC	4.95e-169	21	440	19	441	Probable rhamnogalacturonase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rhgA PE=3 SV=1
sp|Q0CFC7|RHGB_ASPTN	1.07e-167	1	439	1	443	Probable rhamnogalacturonase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=rhgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000269	0.999714	CS pos: 20-21. Pr: 0.9039

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T15893-p1.