CAZyme Information: FGRAMPH1_01T15867-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T15867-p1
• CAZy Family: GH3
• CAZyme Description: Mannan endo-1,4-beta-mannosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
369		41195.22	5.0349

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:8735448-8736557(-)

Full Sequence      

MKAIIPLSLATLAAALPGNIQPRQAKAPVFNIDGKSQYFAGTNTWWMSHLTSDADVEQAM
FQIAKSGLKVTRVWAFGNTNTGTDQPVYFQFLDTAKKTITINKGTNGIARLDAAVAAAEK
HNIQLVLPMLNNWDDLGGINIYCAYFGCTHETFWTHADAQEAYKDYVSFIVNRYKDSPAI
FSWQLCNEPRCQNCDTSVITKWATEISSFIKSLDSKHRVSLGDEGWLCSDDSSLGYAYSC
SEGIDFEANLKISTLDYGTVHMYPIGWGYNYPWGNQWIRDHAALASKYGKPIVMEEYGVE
STTSNRTAVLKEYQETILSTEIAYDSFWQFASNLPSGANPYDAYAIFYGTQEYQDVVIDH
AKTISAKAV

Enzyme Prediction     

EC	3.2.1.78:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	54	330	3.6e-86	0.9930795847750865

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226444	COG3934	2.50e-26	29	344	3	293	Endo-1,4-beta-mannosidase [Carbohydrate transport and metabolism].
395098	Cellulase	2.82e-08	150	333	87	268	Cellulase (glycosyl hydrolase family 5).
397119	Glyco_hydro_2_C	1.33e-04	160	350	107	267	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CZS83030.1|GH5_7	1.70e-282	1	369	1	369
CEF79732.1|GH5_7	1.70e-282	1	369	1	369
CEI68066.1|GH5_7	4.06e-265	1	369	1	369
QKD53737.1|GH5_7	6.28e-243	7	369	7	370
CCT65024.1|GH5_7	3.63e-242	1	369	1	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WFL_A	1.24e-104	30	364	11	342	Crtstal structure of glycoside hydrolase family 5 beta-mannanase from Talaromyces trachyspermus [Talaromyces trachyspermus]
3WH9_A	2.89e-101	30	366	10	344	The ligand-free structure of ManBK from Aspergillus niger BK01 [Aspergillus niger],3WH9_B The ligand-free structure of ManBK from Aspergillus niger BK01 [Aspergillus niger]
1QNO_A	1.12e-100	30	365	12	344	Chain A, ENDO-1,4-B-D-MANNANASE [Trichoderma reesei],1QNP_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei],1QNQ_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei],1QNR_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei],1QNS_A Chain A, Endo-1,4-b-d-mannanase [Trichoderma reesei]
3ZIZ_A	2.75e-97	30	366	23	356	Chain A, Gh5 Endo-beta-1,4-mannanase [Podospora anserina]
4QP0_A	3.36e-78	24	367	6	359	Crystal Structure Analysis of the Endo-1,4-beta-mannanase from Rhizomucor miehei [Rhizomucor miehei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B833|MANB_EMENI	3.77e-124	6	369	16	384	Mannan endo-1,4-beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manB PE=1 SV=2
sp|Q5AVP1|MAND_EMENI	7.58e-107	1	367	5	368	Mannan endo-1,4-beta-mannosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manD PE=3 SV=1
sp|B8NIV9|MANF_ASPFN	1.72e-106	30	365	127	461	Probable mannan endo-1,4-beta-mannosidase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=manF PE=3 SV=1
sp|Q2U2I3|MANF_ASPOR	3.44e-106	30	365	127	461	Probable mannan endo-1,4-beta-mannosidase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=manF PE=3 SV=2
sp|Q00012|MANA_ASPAC	1.52e-105	7	368	8	376	Mannan endo-1,4-beta-mannosidase A OS=Aspergillus aculeatus OX=5053 GN=manA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000327	0.999657	CS pos: 23-24. Pr: 0.9566

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T15867-p1.