CAZyme Information: FGRAMPH1_01T15807-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T15807-p1
• CAZy Family: GT90
• CAZyme Description: agglutinin isolectin 1 precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346		34774.95	4.5631

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:8677529-8678771(+)

Full Sequence      

MEFSLLCLLCVFTPVIASFPRGFEFSNFLILPRADNPTSKDGNCGSNSDNNATCLTSTFG
NCCSEKGFCGKTSAYCGEGCQSGFGTCGSSGGQLVSTSGSCGATSSSNITCQGSEFGNCC
SEKGYCGKTSTYCGTGCQSGFGTCDSEDESSTATTATTATQKTSTTAAASATSLGAISID
GNCGSNSDTNAICEGSEWGDCCSAKGFCGKTSDYCETGCQSKFGSCNSTSSSTTSSESSP
TSSPTSSDSTSSSTSTASASSMTGALTTGAKAGIAVGSVIGGIGVIGLIAWLVMRRKNKK
TAPSAMEVGAAKSPEEPRHELKGDYHAELDGGSRAELPGDFGSYNK

Enzyme Prediction     

EC	-	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
211316	ChtBD1_1	3.94e-09	105	145	4	44	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
211316	ChtBD1_1	9.25e-09	48	88	4	44	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
211316	ChtBD1_1	1.22e-07	187	227	4	44	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
395135	Chitin_bind_1	4.91e-05	43	82	1	36	Chitin recognition protein.
395135	Chitin_bind_1	2.97e-04	117	139	14	36	Chitin recognition protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF79702.1|CBM18	8.18e-120	1	346	1	346
CZS82994.1|CBM18	1.45e-108	1	346	1	349
QPC71990.1|CBM18	5.89e-88	1	346	1	354
CEI63473.1|CBM18	5.09e-58	1	346	1	339
UPK94823.1|CBM18	2.75e-30	1	332	1	320

PDB Hits     

FGRAMPH1_01T15807-p1 has no PDB hit.

Swiss-Prot Hits     

FGRAMPH1_01T15807-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000236	0.999740	CS pos: 17-18. Pr: 0.9799

TMHMM  Annotations     

Start	End
272	294