CAZyme Information: FGRAMPH1_01T15793-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T15793-p1
• CAZy Family: GH3
• CAZyme Description: killer toxin alpha partial

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
657		71904.88	5.5110

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:8660472-8662828(-)

Full Sequence      

MGSIAATTILEHFEKVASEGTQIMQACDINPMNPYTFGVFAIDKISDFELVRKHVQTWTS
GYCAAMPLTRPKDVRTQVNIPGGDLFMGSSNATSVAQSGLPTDREARAECKTTKVGDKDT
CTTLTIRCNIRGADFVKYNTKQNLCSTLKVGQLVCCSSGTLPDNTPKPDSDGTCATHKID
TGDTCASFAATSGITVKDIETYNKKSWAWAGCNRLQMGQVICLSSGNTPMPSTHEGIACG
PQKPGTKRPSGSFDGWDLAKLNQSDTKAPGAFKLKTNGCISNCGTDIVNNKSPPKEFKRI
GYFQAYNPSRPCMNMDATEIAENFEELTHVYFTFAGITADYDVNISDDVKKQFEIFDKMD
APFKKILSFGGWAESTDAATFQRYRDVHSSFDGVDIDWEYPGATDQGIPAGDRTDGLYYY
PFLSVLRNLLPSSKSLSIALPGSYWYLNPFPVDQMAEVLDYFVFMTYDLHGQWDYGNKFA
NPGCDNGNCLRSHINRTETRTSLSMITKAGVPAEKVIVGIASYGRSFRMADNSCTGPDCL
FTGSFEESEAEPGQCTGTGGYILNAEINEIWQLTCCYLRRLGLVNSFSVRDGAAGVPSWN
SSLTWHGRSASHANYTLGVGPLKQGGSQTEMDDCVVFINHIFDAMPNWYKTLSLGVL

Enzyme Prediction     

EC	3.2.1.14:3	3.2.1.14:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	298	569	1.3e-36	0.7432432432432432

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119357	GH18_zymocin_alpha	9.12e-144	298	570	1	286	Zymocin, alpha subunit. Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest. The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation. The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.
214753	Glyco_18	3.68e-42	298	569	1	277	Glyco_18 domain.
395573	Glyco_hydro_18	7.05e-34	298	533	1	233	Glycosyl hydrolases family 18.
119365	GH18_chitinase	1.34e-32	327	528	26	267	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
225862	ChiA	1.11e-28	284	533	23	323	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF79695.1|CBM50|GH18	0.0	1	657	1	657
CZS82985.1|CBM18|CBM50|GH18	0.0	1	573	228	843
CEI63358.1|CBM18|CBM50|GH18	0.0	1	573	223	839
BCS24971.1|CBM18|GH18	2.68e-195	20	567	56	635
ALI93563.1|CBM18|CBM50|GH18	3.80e-191	20	567	255	858

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1HKK_A	8.51e-22	328	567	31	285	High resoultion crystal structure of human chitinase in complex with allosamidin [Homo sapiens]
1HKI_A	8.62e-22	328	567	31	285	Crystal structure of human chitinase in complex with glucoallosamidin B [Homo sapiens],1HKJ_A Crystal structure of human chitinase in complex with methylallosamidin [Homo sapiens],1HKM_A High resolution crystal structure of human chitinase in complex with demethylallosamidin [Homo sapiens]
1LG1_A	1.16e-21	328	567	31	285	Crystal Structure Of Human Chitotriosidase In Complex With Chitobiose [Homo sapiens],1LG2_A Crystal Structure Of Human Chitotriosidase In Complex With Ethylene Glycol [Homo sapiens],1LQ0_A Crystal Structure Of Human Chitotriosidase At 2.2 Angstrom Resolution [Homo sapiens],6ZE8_A Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound OATD-01 [Homo sapiens],6ZE8_B Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound OATD-01 [Homo sapiens],6ZE8_C Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound OATD-01 [Homo sapiens],6ZE8_D Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound OATD-01 [Homo sapiens],6ZE8_E Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound OATD-01 [Homo sapiens],6ZE8_F Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound OATD-01 [Homo sapiens]
1GUV_A	1.18e-21	328	567	31	285	Structure of human chitotriosidase [Homo sapiens]
4WJX_A	1.35e-21	328	567	31	285	Crystal structure of human chitotriosidase-1 catalytic domain at 1.0 A resolution [Homo sapiens],4WK9_A Crystal structure of human chitotriosidase-1 catalytic domain in complex with chitobiose (0.3mM) at 1.10 A resolution [Homo sapiens],4WKA_A Crystal structure of human chitotriosidase-1 catalytic domain at 0.95 A resolution [Homo sapiens],4WKF_A Crystal structure of human chitotriosidase-1 catalytic domain in complex with chitobiose (2.5mM) at 1.10 A resolution [Homo sapiens],4WKH_A Crystal structure of human chitotriosidase-1 catalytic domain in complex with chitobiose (1mM) at 1.05 A resolution [Homo sapiens],5NR8_A Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound 7a [Homo sapiens],5NRA_A Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound 7g [Homo sapiens],5NRF_A Crystal structure of human chitotriosidase-1 (hCHIT) catalytic domain in complex with compound 7i [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P09805|KTXA_KLULA	2.17e-70	130	570	210	655	Killer toxin subunits alpha/beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 PE=1 SV=1
sp|Q13231|CHIT1_HUMAN	1.66e-20	328	567	52	306	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
sp|P36362|CHIT_MANSE	4.06e-16	325	567	50	313	Endochitinase OS=Manduca sexta OX=7130 PE=2 SV=1
sp|P32470|CHI1_APHAL	5.23e-16	326	546	63	316	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
sp|C5P230|CHI1_COCP7	7.16e-16	325	647	62	427	Endochitinase 1 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T15793-p1.