CAZyme Information: FGRAMPH1_01T14595-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T14595-p1
• CAZy Family: GH2
• CAZyme Description: chitin synthase 6

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
749		85901.53	8.2678

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:7102139-7104567(+)

Full Sequence      

MVASHITETDNVRKGKQTWRSQDPQWRKCTPPPPSFFTRVTNNKFVLKDIDGHFHDMQLD
EILQRTSLDDTRSSDQSLGPSVFTASPSYKSSFAQTPITSLKSLYPHSKPGSISPSGSSS
HQGHLIVPQPRLPDPVARRRDSDSLYSVEDISINACAYTANATQTSPRHSLLRQNDTDPT
PKVELDSESQNLDEYLRKYGQRKVTRHKWIMTGFLVSVNFMFIFASWWWPRYYYVYIPFI
SFPLVLNCIMIASIISISIKNLIVTQKIIEPYHNENLIMIMPCYNETLEECTKSLDSLVE
QVGIDNHKRGIMVICDGRVRGPGMEKTTAQYLKEDIFIGKIHSEKIRGAYRAWDGQAMDV
DISWGYYRGVPFYCIIKEQNQGKRDSLIVIRSFLYKFNIRDTKPTTIFSSRFLLSMTDWL
SQEVRVDYVDHLIGMDADTVFQNNCISELLKESKYPNTVGVCGYVAVDFSGGNWNLWSIY
QNAEYTIAQGLRRLHQSIATKKVSCLPGCCQLLKICDMTCGDKVLIEQFGYYPRPLDGMI
KRIRATASEDRNHICQLLTTFPEAQTRQALRARAYTDVPHSWSVFLSQRRRWTLGATSND
LLLFTARHCQWWEPFMHQPWWIIMAFAGIMIVPLIYYVIMAIWLPESMLERFQYLLGLFI
FVVLGPFLNIAVMVFAVFNMDSFGWGKTRKVIVDIPEEQLQEKQNNRDTGSGSNSLPGTF
SSDQREEIATSATARKPAVVYVPPTTQHL

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T14595-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	377	638	2.3e-22	0.4971537001897533

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367353	Chitin_synth_2	1.06e-30	278	691	28	495	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
133033	Chitin_synth_C	7.73e-19	282	593	4	238	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
224136	BcsA	3.12e-12	435	692	144	376	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	1.93e-11	280	512	2	160	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
404513	Glyco_trans_2_3	0.004	566	660	112	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF79100.1|GT2	0.0	1	749	1	749
QPC71516.1|GT2	0.0	1	749	1	775
CZS82385.1|GT2	0.0	1	749	1	754
QPC60232.1|GT2	0.0	1	749	1	777
QKD59723.1|GT2	0.0	1	748	1	770

PDB Hits     

FGRAMPH1_01T14595-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|J9VF17|CHS4_CRYNH	2.81e-25	244	692	475	959	Chitin synthase 4 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS4 PE=2 SV=2
sp|O13395|CHS6_USTMA	8.12e-25	277	692	409	860	Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS6 PE=3 SV=2
sp|P29465|CHS3_YEAST	8.07e-22	278	691	655	1120	Chitin synthase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CHS3 PE=1 SV=3
sp|J9VXM5|CHS3_CRYNH	2.42e-20	278	709	692	1180	Chitin synthase 3 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CHS3 PE=1 SV=1
sp|P30573|CHS3_CANAX	5.14e-20	272	691	659	1130	Chitin synthase 3 OS=Candida albicans OX=5476 GN=CHS3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000000

TMHMM  Annotations     

Start	End
209	231
235	257
620	642
657	679