CAZyme Information: FGRAMPH1_01T14417-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T14417-p1
• CAZy Family: GH2
• CAZyme Description: acetylxylan esterase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
282		29963.33	4.4178

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:6858463-6859481(+)

Full Sequence      

MRPFVLSTAVLVTGAVAQNAWKTCYDGLFMIAARGTNEEKGSGRIGEIAEAVAKRINGSH
VYGLDYPASFQDPAYEDSESDGVKKLKDILSSYFYQCPKNKVAVFGYSQGGQVASDVFCG
GSGGDFPTNKPLTVNDVEKNVVAIITFGDPSHVANVSYDLGSSINDGIFQRNDTKLCEDK
YSGILHAYCDTGDVYCDRGDDTDVHKSYFEKYGKKVEDLVVEKYESAMSESTTTPTADAT
SSVTSAASEVTSTDAPGNGASGLVPGLVLSMVPLALGLSQLL

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T14417-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	30	223	1.7e-38	0.9576719576719577

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	4.17e-31	27	224	4	173	Cutinase.
369775	PE-PPE	3.53e-05	58	117	2	65	PE-PPE domain. This domain is found C terminal to the PE (pfam00934) and PPE (pfam00823) domains. The secondary structure of this domain is predicted to be a mixture of alpha helices and beta strands.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CZS82301.1|CE5	4.54e-200	1	282	1	282
CEF79011.1|CE5	4.54e-200	1	282	1	282
QPC60162.1|CE5	5.22e-190	1	282	1	282
QPC71449.1|CE5	2.12e-189	1	282	1	282
CEI62692.1|CE5	3.60e-181	1	282	1	282

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1BS9_A	4.74e-21	28	215	5	197	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
1G66_A	4.74e-21	28	215	5	197	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
2AXE_A	6.64e-20	28	215	5	197	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O59893|AXE2_TALPU	4.24e-20	28	215	32	224	Acetylxylan esterase 2 OS=Talaromyces purpureogenus OX=1266744 GN=axe-2 PE=1 SV=1
sp|A0A2J8C362|CUTI1_VERDA	1.07e-17	28	233	28	238	Cutinase 11 OS=Verticillium dahliae OX=27337 GN=VD0003_g7577 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.783231	0.216799

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T14417-p1.