CAZyme Information: FGRAMPH1_01T14009-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T14009-p1
• CAZy Family: GH18
• CAZyme Description: pectate lyase h

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306	HG970333|CGC45	33970.03	4.7271

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:6392319-6393390(+)

Full Sequence      

MKASLLLSLLPLAHGAAIDTRQSKTGDGKQGDTDATQGDLSERPPPRFPFPITKFPVAKE
TVVFKNAKYIMPGEVFDGKMKRYERPEGSCNEQAEGTDADTVFNLMPGATIRNVIIGKHQ
AEGIHALGDAWVENVWWEDVCEDALTSKGLNTQLRVIGGGARSATDKIFQDNSLGGKYNI
TGFYAEGFGTFYQSCGNCLNQAKRNATIQNVVARDGLRMGIINPNFGDEFRLKNAQIDNV
TSICDKEIGNNVQTVPYYIGNGPDEKYALYNETRDNITKFKGEVKLAYEPEDPYEWLEEF
WPEGFN

Enzyme Prediction     

EC	4.2.2.2:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	59	247	1.8e-72	0.979381443298969

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	4.51e-79	53	249	2	195	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CZS82099.1|PL3_2	1.40e-231	1	306	1	306
CEF78807.1|PL3_2	1.40e-231	1	306	1	306
QPC59987.1|PL3_2	1.15e-230	1	306	1	306
CEI62499.1|PL3_2	4.38e-210	1	306	1	306
QPC71295.1|PL3_2	4.38e-210	1	306	1	306

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	4.20e-21	61	211	3	150	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	3.74e-17	57	197	9	139	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	3.82e-17	57	197	10	140	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]
4Z03_A	3.09e-16	57	197	18	148	C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725],4Z03_B C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725]
4YZ0_A	3.09e-16	57	197	18	148	C. bescii Family 3 pectate lyase double mutant K108A/E39Q in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725],4YZ0_B C. bescii Family 3 pectate lyase double mutant K108A/E39Q in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WGV9|PLYD_ASPFU	1.39e-49	50	265	20	231	Probable pectate lyase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyD PE=3 SV=1
sp|B0YB89|PLYD_ASPFC	1.39e-49	50	265	20	231	Probable pectate lyase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyD PE=3 SV=1
sp|Q0CCF8|PLYF_ASPTN	3.44e-48	57	238	25	209	Probable pectate lyase F OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyF PE=3 SV=1
sp|A1DCY5|PLYD_NEOFI	4.21e-48	52	265	16	230	Probable pectate lyase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyD PE=3 SV=1
sp|A1D5E3|PLYF_NEOFI	3.82e-47	57	238	25	209	Probable pectate lyase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000596	0.999380	CS pos: 15-16. Pr: 0.9683

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T14009-p1.