CAZyme Information: FGRAMPH1_01T13909-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T13909-p1
• CAZy Family: GH18
• CAZyme Description: feruloyl esterase b

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331		35335.51	5.5921

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:6272957-6274009(+)

Full Sequence      

MLDSFSPRKVLTTLALGAGLVAAQFPPQGPPQGQFQGQPQGTPQGAPQGAPQGAPQGQAA
LQTITDFGEIYNTQLKLQAYIPSNLPASPSIILALHMCGGTGEQYFQQTNYKSMADQKGV
VVLYPSSPKDDNCWDVASKQTLMHDGQGDSQALINMVDWAIKQFNADPKKVFVTGSSSGC
MMTNVMAATYPDRFAAATCYSGVAAGCMAGAPGSSPNSSGRECSDGKVRKSGEDWAAQVR
AMYPGYKGAYPKFKTFHGTADYFVFYQNFLEQVKEWSAIHGVESTGKETDGQGYTTETFG
DGSKFVSVSAEGVGHTVPVHPDLDFQWFGLN

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T13909-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	72	268	8.6e-23	0.7841409691629956

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
273828	esterase_phb	7.74e-37	79	290	3	208	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
226040	LpqC	4.82e-20	80	318	52	277	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
402228	Esterase_phd	2.53e-18	80	268	6	187	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
395257	Peptidase_S9	6.10e-08	146	204	41	99	Prolyl oligopeptidase family.
224423	DAP2	9.31e-08	146	203	450	507	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF78757.1|CE1	2.17e-218	1	331	1	331
QPC71255.1|CE1	3.47e-216	1	331	1	307
QPC59944.1|CE1	2.96e-215	1	331	1	327
CZS82047.1|CE1	6.60e-214	1	331	1	335
QKD62144.1|CE1	1.18e-142	1	330	1	296

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	3.33e-78	60	330	3	274	Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2QZI3|AXE1_ASPNC	5.66e-80	60	330	31	302	Probable acetylxylan esterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=axeA PE=3 SV=1
sp|Q96W96|AXE1_ASPFI	1.13e-79	60	330	31	302	Acetylxylan esterase A OS=Aspergillus ficuum OX=5058 GN=axeA PE=1 SV=1
sp|Q92194|AXE1_ASPAW	4.25e-77	60	330	32	303	Acetylxylan esterase A OS=Aspergillus awamori OX=105351 GN=axeA PE=1 SV=2
sp|B8M9H9|FAEB_TALSN	1.09e-76	59	330	19	291	Feruloyl esterase B OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) OX=441959 GN=faeB PE=1 SV=1
sp|Q9HE18|FAEB_TALFU	2.11e-75	59	330	19	291	Feruloyl esterase B OS=Talaromyces funiculosus OX=28572 GN=FAEB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.102479	0.897506	CS pos: 23-24. Pr: 0.6020

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T13909-p1.