CAZyme Information: FGRAMPH1_01T13741-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T13741-p1
• CAZy Family: GH17
• CAZyme Description: mannosyl phosphorylinositol ceramide synthase sur1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364	HG970333|CGC2	41977.16	6.3814

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:6096576-6097728(-)

Full Sequence      

MSSSPILGPSRADCQSPYDEEHMDWASSVPKKYHRVPRLLRRSNVILVLIDIFIVTVLVH
IFWPLITLLRRNEELFGARLTFTLNDTSIPPTLPEQQTIPRIFHQTSANETIPEAWTDLV
QSCKTTYSDFTYMHWTDDKARDFISEEYPWFIDTWDNFPFNIQRADAIRYFVLHHYGGMY
LDMDTLCNASIPFEQIEAIGAKHHAVFKSTTPTGVSNDMMITSARHPAFTKALSRIQLYN
DITKPWRHIVPHVAVMVSAGPLFLTMALKNYLLEQPSLPEQTVQVINATSLEPYLTDYEG
ASWHHGDTKALMWVGDRPWVWYALGAIGLCAGLYLLNMLMMKCWTRFFDKTSSNDEYKES
IKLT

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T13741-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	116	192	1.7e-21	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	4.04e-43	94	344	77	317	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	9.92e-19	113	192	1	84	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SCB65856.1|GT32	1.06e-278	1	364	1	364
QPC71180.1|GT32	1.06e-278	1	364	1	364
QPC59875.1|GT32	1.06e-278	1	364	1	364
CZS81964.1|GT32	5.24e-277	1	364	30	393
CEI62385.1|GT32	1.31e-265	1	364	1	363

PDB Hits     

FGRAMPH1_01T13741-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	2.66e-47	40	311	1	259	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	2.62e-44	71	342	61	317	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|P38287|CSH1_YEAST	5.31e-44	40	309	1	265	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|O14084|IMT1_SCHPO	5.72e-43	71	317	39	274	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q10323|IMT3_SCHPO	3.15e-37	99	360	57	334	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000014	0.000013

TMHMM  Annotations     

Start	End
45	67
319	341