CAZyme Information: FGRAMPH1_01T13325-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T13325-p1
• CAZy Family: GH16
• CAZyme Description: Choline mitochondrial

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
598		63890.98	9.2715

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:5642230-5644104(-)

Full Sequence      

MLVKPQLWLAFAAAAVAAPSQDAYDYIVVGGGTAGVAVAARLSEGLPSSKILLIEAGPAA
LDEPKINVPGLKGTTLGTKYDWNFTTVPQTGANDRVWPINRGKVLGGSSALNLMTYDRAS
AAEYDSWEALGNPGWNWKTMIKAMMKSETFTGKNTATYGSKGVGDSGPVQAVVNRVIPKH
QESWIPTLNKLGIRKNLESLGGDPLGVMYQPSSIDPANYKRSYSANAYDEISGSNLEIAT
DTTVTKINLSAPKGKKKAIATGVTLADGTIIKASREVILSAGSIQSPPLLEQSGIGSKSV
LAAASIKQIIDLPGVGENLQDHLRIMSSYQLKPQFTSIDIFKSNATFAAEQMALWNAGKQ
SLYDYTGSAYTFSTWKQALGSNAKLLSLAKEAVAKDGSKVDKKKLDFFKDSSVPQVEVIF
SDGYTGVKGYPAATSPLFGKGFVSLIAVVMHPLSRGSVHINPSDPAGKPIINPNYLSHAH
DVEAVTQAVKYNRKIANTEPMRSIWDDEYEPGLDVKTDEQLKAYALRTTLSIFHPTGTCA
MLPKNDGGVVDAKLKVYGTENLRVVDASIMPLLISAHIQTAVYGIAERAAEFIIAAAK

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T13325-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	23	595	6.3e-184	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	4.96e-97	24	593	6	531	choline dehydrogenase; Validated
225186	BetA	1.19e-94	24	598	8	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	2.00e-46	452	589	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.41e-29	99	323	21	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	8.62e-17	20	569	52	552	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF78466.1|AA3_2	0.0	1	598	1	598
CZS81759.1|AA3_2	0.0	1	598	1	598
QPC59688.1|AA3_2	0.0	1	598	1	606
QPC70868.1|AA3_2	0.0	1	598	1	598
CEI62186.1|AA3_2	0.0	1	598	1	598

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	2.16e-84	24	593	6	564	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	1.43e-77	24	593	6	582	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	5.19e-70	21	594	33	639	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
5OC1_A	5.19e-67	24	593	2	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	7.50e-66	24	593	3	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|M5EAX2|GMCH_MALS4	4.25e-96	24	594	47	616	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	4.25e-96	24	594	47	616	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|A0A2H3D1U1|ARMD5_ARMGA	3.79e-83	20	593	36	629	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	1.13e-80	21	595	11	618	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A142PTM2|CITC_MONPU	3.55e-77	21	593	11	608	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.012956	0.987024	CS pos: 17-18. Pr: 0.9406

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T13325-p1.