CAZyme Information: FGRAMPH1_01T13277-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T13277-p1
• CAZy Family: GH16
• CAZyme Description: beta-glucosidase b

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
837	HG970333|CGC49	90827.57	5.6609

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:5589793-5592400(-)

Full Sequence      

MANIEIDKIINSLTLEEKISLLAGKSFSETVGIPHKGIPSIKTADGPNGIRSAATDLDIK
SACFPAACNLAATFDVDLAEQFGRALGVEARGKGVNCMLGPTVCMHRHPLGGRNFESYSE
DPFLTGKMSSKVIQGLQSLGVSATIKHFVANEQETARTTVDEAIDERTLREIYLRPFEIA
VKEANPWAVMTAYNHINGVHCDEHKWLLEGVLRGEWGWKGLVMSDWGGTNSVAAALNAGL
DLEMPGPPRLRKEDAVKQALQTGELSEDTINQRVRTLIEWATKLKALEAESQSVVLGQDT
NTPELRKMIREAGARGIVLLKNDQGILPLSKQKVQKKRVALIGFAKDAMAHGGGSASVNA
YRKVTPWQGLHEALGDDVKFTFAKGAHKERLLPAIQPTGSAGTVVGLDGKPGFSRQLFKE
GEDSPVSTIGQPTSAYSPLGSQESLWRRLEIVGDFTPSETGSHYIACSGLGPTRVYVDGE
IIYEQTANCTDPMGSLFLAAPEPEFRHNFEAGKKYRLRICSDPPTKIGLTILEGRSGVRV
GFSLESDHDADLVGEAAQVAKDADYAIVFTGHDPQWETEGRDQDSFNLPRKGTQDDLVTT
VASVNPNTIVVNSTGVAIAMPWLENVPAVVQAWFPGQECGYSIADVLTGAVNPEGRLPVS
FPKHIEDCPAHGNFPGEYVDGKLKVKYEEGIFIGYRHFDRIAKDKVNFPFGHGLSYTSFG
YELSDIAREGNGWSIVTQVSNTGQQAGGALVQVYVGRAEQSSEHPVKTLSAFQKVRLQPG
ETKEVKLKVAERDLAYFDTGKGKWVVDEGEYQFSLGSSSAEIVGQKVVRVEGASFDP

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	33	245	9.1e-71	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.78e-76	25	364	47	379	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	3.93e-70	64	836	120	763	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	1.01e-54	317	695	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.49e-46	37	279	65	315	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	2.32e-41	9	816	56	769	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF78442.1|GH3	0.0	1	837	1	837
CZS81735.1|GH3	0.0	1	837	1	837
QPC70884.1|GH3	0.0	1	837	1	837
QPC59666.1|GH3	0.0	1	827	1	827
CEI62171.1|GH3	0.0	2	837	3	838

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	4.52e-176	1	831	1	837	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	7.48e-171	5	831	5	837	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.11e-133	4	830	3	668	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	4.84e-118	5	822	3	705	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	7.20e-117	5	822	3	705	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	2.67e-315	5	837	10	845	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|P27034|BGLS_RHIRD	1.77e-183	6	822	2	802	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|Q5BA18|BGLK_EMENI	1.21e-176	5	831	12	830	Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglK PE=2 SV=1
sp|A1DFA8|BGLI_NEOFI	1.71e-176	1	823	1	823	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	6.95e-176	1	835	1	835	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.994586	0.005460

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T13277-p1.