CAZyme Information: FGRAMPH1_01T13239-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T13239-p1
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
572		64656.81	7.6975

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:5548032-5549750(+)

Full Sequence      

MFKIKDFTGMQYSRDGPSIGKHDYEYFNQQYATSSHQVDHDMNPALIVQPKEDNDVVKVV
QWAKDNKVSVAVKSGGHQYSGASSTGGKNIQIDLSNTYKDMMVIDAPGIPEDRALVYIGV
SNRLQDFNAYLRHNDLFVPHGQCAYVCTGGHGQTGGYGQLGRSFGLFGDHIISIRMVDHN
GSIQEVTKKSDSELFYAILGGSPGNFGIITHYTIEVYRGASYMGTVAGPNNFKGPHGLKG
LWLYEPKVLSRLLGTIAKMSDEGTAPRGYDLCCSVLSTEFPITMLFPSMQDDTIWQKVQN
KIKNALSQEVLNLLNGSFPAVIVLYAQWCPINKTDKYDATVDKWFQQFRDFQKDWKNHTL
RIEEFDESMAKLTGKWIFPKAREFDLPYVKRTYATKSQTLQKDGWVDATVKRLDLIYNPQ
QKLGNDKSDKEGEVYDHCKLSVQIQCFGGQNSRFFANKDNGTSYSWRDSTVVQTLDCFHD
PGDQYKQYAVNWQAKNDSIMIGPNSPFSKKDRRVLWGSWGDWDMSKPEIWQAYYEDADKY
KRLGKTRARADPDGTFTANPFAVTAVKDGAKL

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	41	217	2.9e-48	0.36681222707423583

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	3.32e-14	44	226	32	213	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	1.24e-12	44	187	1	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
215242	PLN02441	0.006	187	210	210	232	cytokinin dehydrogenase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UKZ49297.1|GH31	9.35e-117	24	567	19	523
UKZ75824.1|GH31	2.08e-115	24	567	19	523
UPK91582.1|GH31	4.68e-113	24	567	17	520
QYS96687.1|GH31	7.22e-113	24	567	19	523
CCA69005.1|AA7	1.34e-18	44	213	58	220

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3POP_A	1.49e-15	18	212	12	204	The crystal structure of GilR, an oxidoreductase that catalyzes the terminal step of gilvocarcin biosynthesis [Streptomyces griseoflavus],3POP_B The crystal structure of GilR, an oxidoreductase that catalyzes the terminal step of gilvocarcin biosynthesis [Streptomyces griseoflavus],3POP_C The crystal structure of GilR, an oxidoreductase that catalyzes the terminal step of gilvocarcin biosynthesis [Streptomyces griseoflavus],3POP_D The crystal structure of GilR, an oxidoreductase that catalyzes the terminal step of gilvocarcin biosynthesis [Streptomyces griseoflavus],3PQB_A The crystal structure of pregilvocarcin in complex with GilR, an oxidoreductase that catalyzes the terminal step of gilvocarcin biosynthesis [Streptomyces griseoflavus],3PQB_B The crystal structure of pregilvocarcin in complex with GilR, an oxidoreductase that catalyzes the terminal step of gilvocarcin biosynthesis [Streptomyces griseoflavus],3PQB_C The crystal structure of pregilvocarcin in complex with GilR, an oxidoreductase that catalyzes the terminal step of gilvocarcin biosynthesis [Streptomyces griseoflavus],3PQB_D The crystal structure of pregilvocarcin in complex with GilR, an oxidoreductase that catalyzes the terminal step of gilvocarcin biosynthesis [Streptomyces griseoflavus]
6FYD_A	3.03e-15	41	218	42	210	The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_B The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_C The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_D The crystal structure of EncM T139V mutant [Streptomyces maritimus]
6FYF_A	5.35e-15	41	218	42	210	The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_B The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_C The crystal structure of EncM V135M mutant [Streptomyces maritimus],6FYF_D The crystal structure of EncM V135M mutant [Streptomyces maritimus]
6FYB_A	7.11e-15	41	218	42	210	The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYB_B The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYB_C The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYB_D The crystal structure of EncM L144M mutant [Streptomyces maritimus],6FYC_A The crystal structure of EncM L144M mutant complex with dioxygen under 15 bars O2 pressure [Streptomyces maritimus],6FYC_B The crystal structure of EncM L144M mutant complex with dioxygen under 15 bars O2 pressure [Streptomyces maritimus]
6FYG_A	7.11e-15	41	218	42	210	The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_B The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_C The crystal structure of EncM V135T mutant [Streptomyces maritimus],6FYG_D The crystal structure of EncM V135T mutant [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54H55|Y8969_DICDI	4.81e-18	44	306	48	309	FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0289697 PE=2 SV=1
sp|O06997|YVDP_BACSU	1.11e-17	41	218	30	200	Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) OX=224308 GN=yvdP PE=1 SV=1
sp|Q9SA89|BBE12_ARATH	1.66e-17	44	216	77	246	Berberine bridge enzyme-like 12 OS=Arabidopsis thaliana OX=3702 GN=At1g30740 PE=2 SV=1
sp|Q9SVG3|BBE21_ARATH	1.70e-17	8	223	54	269	Berberine bridge enzyme-like 21 OS=Arabidopsis thaliana OX=3702 GN=At4g20840 PE=2 SV=1
sp|Q9SVG4|RETOL_ARATH	9.69e-16	28	216	76	254	Berberine bridge enzyme-like 19 OS=Arabidopsis thaliana OX=3702 GN=At4g20830 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000001

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T13239-p1.