CAZyme Information: FGRAMPH1_01T13095-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T13095-p1
• CAZy Family: GH15|CBM20
• CAZyme Description: glycosyl hydrolase family 17

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
301		33459.14	9.7934

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:5385061-5386020(-)

Full Sequence      

MKFFSTLSTLAVALMMTGEAVAGTYKGFSMGANRADGVCKWEADWKKDFQAIKSWNKGFN
AVRLYSASDCNTLVKAVPAAKATGMKILVGIWSTDDAHFGRDKAALLKAIKQHGTGWIAA
ISVGSEDLYRKDISPQKLAQQIYDVRGMVHQYNKALKVGHTDTWTAWVDGTNDVVTKACD
IAITNGFPYWQGVPIKDALRLKTFQNSYWNVKKHVQAVNSKATVWVGETGWPTKGPNYQK
AAATTASLQQYYNNVGCWLWQQKDASGFWFTAFDTPAQTTEVEKYFGVANQDRKLKFSLT
C

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T13095-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	56	301	1.9e-30	0.9196141479099679

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	2.89e-58	1	293	5	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.45e-19	27	301	2	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAO34674.1|GH17	3.17e-230	1	301	1	301
CZS81646.1|GH17	3.17e-230	1	301	1	301
CEF78351.1|GH17	3.17e-230	1	301	1	301
QPC59593.1|GH17	1.29e-229	1	301	1	301
QPC70955.1|GH17	3.70e-229	1	301	1	301

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.72e-34	16	300	24	293	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.29e-33	16	300	24	293	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13990|BGL2_SCHPO	5.52e-62	4	301	9	318	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4
sp|P15703|BGL2_YEAST	2.13e-56	1	301	1	310	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|P43070|BGL2_CANAX	1.05e-44	2	301	4	305	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|Q5AMT2|BGL2_CANAL	3.17e-43	2	301	4	305	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|D4B2W4|BGL2_ARTBC	1.74e-42	4	301	3	301	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000241	0.999768	CS pos: 22-23. Pr: 0.9761

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T13095-p1.