CAZyme Information: FGRAMPH1_01T12973-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T12973-p1
• CAZy Family: GH15
• CAZyme Description: alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
615		67243.18	5.1493

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:5250500-5252459(-)

Full Sequence      

MMPSIDEFSHLAFDFIVIGGGTAGLAVAARLAESNTSYTIGVIEAGGVVQNDPDVDIPGH
YGRSLGGSYDWKLETTPQKGLGGRVLPWPRGKVLGGTSALNYMAWNRASRDDYDAWEALG
NEGWGWDGLLPFFKRSETFHPPSQKTQNEHEISHDADTLGDSGPISISYPTDYSSSHSLW
HRTLNGLGVQTNTAHLGGSNVGVWTCINAVDPSSARRSYALDYCASHPHNLHILTNATVN
EIVISEDKVATGVHLTHHGEEYTVSASREIILSAGSVKSPQILELSGIGNPEVLDRAGVP
VKVESLHVGENLQEHIMLATIFEVDPSLANRDDLQKDEKLTLAAQEQYAQTADGPLTILP
VSICYVPLAHFVSKDTLSSLHAEADQISEFDADKHDILTHRLNGNSKLGQIEYIFDLGNW
NTYFQGEEGKKYGTMLQILQYPFSVGSIHIRPSHSGSSPAEQSPDIDPKYYEGTHGKLDM
EVMKHCLQFVQKIVNAEPLSNIIHAPASPPTAAYDDDKLMEEWITQNTITDWHPVGTCAM
GGRAGIEGGVVDERLRVYGVRGLRVVDASIMPLQVSAHIQATVYAIAEKAAHMIIEDARS
ADMARGDFWRHQTRL

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T12973-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	13	597	3.4e-185	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.91e-94	13	601	8	540	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	6.58e-79	13	594	6	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.23e-35	442	590	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.38e-31	82	315	15	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.85e-23	9	583	52	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF78290.1|AA3_2	0.0	1	615	1	615
CZS81587.1|AA3_2	0.0	1	615	1	615
QPC59540.1|AA3_2	0.0	1	615	1	618
QPC71002.1|AA3_2	0.0	1	615	1	617
CEI62033.1|AA3_2	0.0	1	615	1	618

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	4.12e-80	13	601	6	571	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	2.69e-68	10	601	3	589	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	7.38e-59	13	597	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
6O9N_A	1.67e-58	13	597	36	641	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
3FIM_B	3.84e-58	13	597	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A142PTM2|CITC_MONPU	6.52e-98	7	597	8	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A161CEV4|CITC_MONRU	6.52e-98	7	597	8	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	1.39e-91	7	597	34	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	1.89e-91	4	597	5	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|Q5GMY3|GMCH_MALSM	9.05e-86	12	595	46	616	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.995050	0.004990

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T12973-p1.