CAZyme Information: FGRAMPH1_01T12809-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T12809-p1
• CAZy Family: GH132
• CAZyme Description: pectinesterase precursor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326	HG970333|CGC41	34552.35	9.2289

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:5056834-5057910(-)

Full Sequence      

MKIFATLNFVTAVLAASRTTAPSGCITVKKGGQFGTIQSAVNSLSTTASGSQCIFIDQGT
YNEQVLVSARNAQLTIYGYTTDTSGYAGNKVTITAKKSQADGLNNDGTATLRVKAANFKL
YNVNVANTYGQGSQAVALSAYADSGYYGVALTGFQDTLLAQEGYQLYSKCMIAGATDFIF
GQRASAWFEKNDLRVVSASVGYITANGRDSDSNPSNYVFNNCNIAAAAGNNVANGAYYLG
RPWREYSRVTFQKTSMSAVIHPAGWSIWNKGEENTGHVQFSEFGNTGAGSTGARASFSKK
LSSAVSISTVLTSSYASKGFYDASYM

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T12809-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	28	304	8e-76	0.9409722222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178051	PLN02432	1.21e-41	32	304	21	275	putative pectinesterase
178113	PLN02497	4.85e-41	32	302	42	307	probable pectinesterase
395871	Pectinesterase	1.52e-38	32	298	10	275	Pectinesterase.
215357	PLN02665	7.26e-37	26	302	70	341	pectinesterase family protein
178346	PLN02745	3.38e-36	13	294	274	556	Putative pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF78207.1|CE8	1.34e-230	1	326	1	326
CZS81503.1|CE8	1.34e-230	1	326	1	326
QPC59472.1|CE8	9.05e-229	1	326	1	326
QPC71066.1|CE8	6.11e-227	1	326	1	326
CEI61946.1|CE8	1.80e-219	1	326	1	326

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	3.18e-69	17	311	2	287	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	3.18e-69	17	311	2	287	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	3.80e-28	17	326	2	302	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	4.78e-25	32	289	13	268	Chain A, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	4.72e-11	36	291	17	312	Chain A, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	1.56e-98	2	325	4	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	3.57e-97	2	326	4	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|A1DBT4|PMEA_NEOFI	7.69e-70	16	317	26	318	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	1.54e-69	16	311	26	312	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	1.54e-69	16	311	26	312	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000253	0.999728	CS pos: 15-16. Pr: 0.9811

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T12809-p1.