CAZyme Information: FGRAMPH1_01T12753-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T12753-p1
• CAZy Family: GH131
• CAZyme Description: exopolygalacturonase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
485		54304.05	6.0751

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:4996351-4998082(-)

Full Sequence      

MRLHLTLGFLAALAITAIDAVSLPQDVPRDVSGFRKKHPYTPPMHEHRKIIRIRSSKNHQ
DDVSKDFERGIRQADRGSTLYLPHGQTFVIGKALDLTGLSDIHVRLDGEIRFTDDVEYWQ
ENAWYHPFQKSIMFWKWGGQNIKIYGSGVIEGQGYLMANGSRQRWWNEFEAGTGSILNPD
NKYYRPILFYAENTTNLDISGIHLKDSPCWNNFIVSSKNITYTDVVATALSNNGSIIPKN
TDFMNTMNTSTVRIERTWVNIDDDCFSPKPNSSDLYVNTMYCNGTHGQSMGSLGQYKGEV
SNVHDVHIENVWMLNGDYSGARIKVWAGNETGTGFVNNVTFKNFWVARMDYGIFLDSCYF
NKSADECNAHPSGMQITNIHFENFTGYTSGVYGNAVARLSCSSAEDAVCANITLKDFDVK
SPCGGEPIVICDGMHGDVGVDCVPYESDEAQMALKAKCKIPLVPIDTDPWGSGLIEKKNC
AFHPE

Enzyme Prediction     

EC	3.2.1.67:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	73	436	2.1e-61	0.963076923076923

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	1.45e-38	91	435	14	316	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215540	PLN03010	8.21e-25	78	437	81	392	polygalacturonase
215426	PLN02793	1.38e-24	82	425	90	400	Probable polygalacturonase
178580	PLN03003	5.62e-22	149	425	116	363	Probable polygalacturonase At3g15720
177865	PLN02218	1.54e-21	79	420	102	409	polygalacturonase ADPG

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF78179.1|GH28	0.0	1	485	1	485
CZS81479.1|GH28	0.0	1	485	1	485
QPC59449.1|GH28	0.0	1	485	1	477
QPC71083.1|GH28	0.0	1	485	1	477
QKD61505.1|GH28	1.65e-314	1	485	1	477

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	6.44e-51	61	442	30	382	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1HG8_A	8.12e-15	91	386	31	303	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]
1RMG_A	2.15e-10	250	436	184	355	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]
1BHE_A	7.20e-08	141	391	110	340	Chain A, POLYGALACTURONASE [Pectobacterium carotovorum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DAX2|PGXB_NEOFI	6.05e-144	12	442	26	431	Probable exopolygalacturonase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pgxB PE=3 SV=1
sp|Q873X6|PGXB_EMENI	1.58e-143	1	446	1	440	Probable exopolygalacturonase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pgxB PE=2 SV=1
sp|Q0C7H7|PGXB_ASPTN	1.08e-142	9	442	4	430	Probable exopolygalacturonase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pgxB PE=3 SV=1
sp|Q2TW03|PGXB_ASPOR	1.13e-139	9	442	4	430	Probable exopolygalacturonase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pgxB PE=3 SV=2
sp|B8NX60|PGXB_ASPFN	1.61e-139	9	442	4	430	Probable exopolygalacturonase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pgxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000203	0.999758	CS pos: 20-21. Pr: 0.9706

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T12753-p1.