CAZyme Information: FGRAMPH1_01T12723-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T12723-p1
• CAZy Family: GH13
• CAZyme Description: Choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
545		59005.16	4.8712

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:4958805-4960554(+)

Full Sequence      

MHDYIIVGGGLSGCVLASRIREYDERSTILLIEAGKDTRGRPDVQNMQVLNLGGDLDWQY
ESEPVAGLAGRRVTLNAGKGLGGGSAINSGGWTRGASVDYDEWASLVGDDRYSYNGQLPW
FKKSERWFDNNDPAQHGQDGPMRITCAKASNRRFPLAEQAAAGWEDLGIYTLPNGDQNAG
DNLGRAYICEARSDGKREWSAEQYSLEGVDVRLETSVQRIVLQNCDGKLKATGVKLADGS
IASGNNVILSAGALRSPQLLQLSGIGSSSHLQEVGIEPLVDLPEVGENLADHMIFFQHWR
LRDPSAGYTLGSDNLLFQQPQYSQGVPVDWIVNTSVASDGLAKAIAVDESVQPETSKHSL
LAKKRTFLENILMYAKVPFPGVPVDAEHITTAVVTFLPTSRGSVALKSGNPDDHPKVNPN
YLATEVDRHVFREGLRQLTRFMLESKFSVNIAGESVPEGLPAEPLGLDDNDEKLDQRLAM
TSGTSWHPTGTCSMGKVVDTEFRVRGIEGLRVVDASVIPVPISAHIQAPLYALSEQAAAI
ITGNA

Enzyme Prediction     

No EC number prediction in FGRAMPH1_01T12723-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	2	542	1.1e-138	0.9911971830985915

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	4.42e-95	3	545	7	535	choline dehydrogenase; Validated
225186	BetA	3.49e-92	3	545	9	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	3.29e-38	398	537	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.58e-31	2	517	56	552	Protein HOTHEAD
366272	GMC_oxred_N	2.28e-28	70	294	16	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF78164.1|AA3_2	0.0	1	545	1	545
CZS81463.1|AA3_2	0.0	1	545	1	545
QPC59438.1|AA3_2	0.0	1	545	1	545
QPC71096.1|AA3_2	0.0	1	545	1	545
CEI61884.1|AA3_2	0.0	1	544	1	544

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZH7_A	2.23e-58	2	545	8	564	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YRU_AAA	2.23e-58	2	545	8	564	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
7AV4_AAA	2.24e-58	2	545	84	640	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	2.99e-58	2	545	24	580	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
6YS2_AAA	3.10e-58	2	545	8	564	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1L9WN49|ACUG_ASPA1	2.30e-87	3	538	6	515	GMC-type oxidoreductase acuG OS=Aspergillus aculeatus (strain ATCC 16872 / CBS 172.66 / WB 5094) OX=690307 GN=acuG PE=3 SV=1
sp|C3K3D3|BETA_PSEFS	6.45e-63	2	544	5	536	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=betA PE=3 SV=1
sp|Q3K5H3|BETA_PSEPF	2.43e-62	3	544	6	536	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=betA PE=3 SV=1
sp|Q4K4K7|BETA_PSEF5	4.70e-62	2	544	5	536	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=betA PE=3 SV=1
sp|A7MFA8|BETA_CROS8	2.91e-61	3	544	4	534	Oxygen-dependent choline dehydrogenase OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999970	0.000071

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T12723-p1.