CAZyme Information: FGRAMPH1_01T12467-p1

Basic Information

• Species: Fusarium graminearum
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium graminearum
• CAZyme ID: FGRAMPH1_01T12467-p1
• CAZy Family: GH128
• CAZyme Description: related to beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1049		117668.72	5.4182

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_FgraminearumPH-1	14145	229533	2	14143

• Gene Location: location=HG970333:4681944-4685194(-)

Full Sequence      

MGGGIAEQPKGISLQEDASRPDYINEAVFRRNTLPTRAYHIPETSISLNGTWDFSLSGTA
IEAPEPSSKDITYEPIQVPGHWQLQGHGKPWYTNVQYPIPVCPPYVPTENPTGSYRRDFH
VPAGWDANSQLRLRFDGVDSAYHVFVNGTLVGYAQGSRNPSEFDISAFVNREGANELFVR
VYQWSDATYIEDQDQWWLSGIFRDVYLISFPAARIDDFFVKPDLDSSYKNGTLTTSVDIF
TDKAGVLELTLSELAKNGGAVISSTKTSVDAKSNKIDLKLEVEDPKKWTAETPYLYSAEL
TLKSEDSKTVLHSVQQRVGFRKVELKDGLMTVNGKRIRLRGVNRHEHHPLLGRSVPIEFA
KRDLLIMKKHNINALRCAHQPHDPRILDLCDEYGLWVMAEADLECHGFYDAVARPLDIPE
SMDYGERKKLAFGKAAQFTSNNPDWKEAYLDRINAVLNRDKNHASVIIWSFGNEAFYGDN
HRAMFKYATEADPSRLIHYEGDEQAETTHMYSYMYPTVERLIKYAKEEGVKDGKFEKPIV
LCEYGHAMGNGPGWLEDYEQAFRDYPRLQGGFIWEWANHGLWKDDHEGAGYYAYGGDFGD
TPNDGTFVMDGLLNSQHEPTPGLVEFKKVIQPVGFSYSDGELKIENRQDFAGLENLTASY
KIEQLGQEATLIHSASFDVPEILAGETKSVSLPVDNKKFNKDSEVYLTVTLSLKHSTAWA
PAGHEIAWSQHQLQAPQTSAKATSVASNTLSSKLDVSQKTSTVTISGKDFEFTFNRAYGT
LKSWISNGKTVLDFDPKTKAAIIPSFWRPKTDNDVPGAVPYWERFGVDQLESQLRSFTVD
ASSDKVVLKSKTFITPPVLFWGWDCEIEYTVSLNGSLSVNVTRLSPQGSVPDHVPRIGLN
LWGSKTLEHVKWLGLGPGESYPDKKTSQRVGIWNVESISDLQVPYDVPQENGNREDTRWV
SLRDSKSPSVGLRASRLDGAHFSFLASNHRDTTIQDAKHPPDLFEEDAVFIRLDHKVAGV
GSGACGPAVREDLMVKTEETTFGFLLEPL

Enzyme Prediction     

EC	3.2.1.23:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	41	930	1.9e-224	0.9654255319148937

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236548	lacZ	0.0	12	1021	6	998	beta-galactosidase.
236673	ebgA	0.0	48	1049	44	1000	cryptic beta-D-galactosidase subunit alpha; Reviewed
225789	LacZ	1.67e-169	46	932	13	808	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
397119	Glyco_hydro_2_C	6.75e-116	323	635	1	302	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
214988	Bgal_small_N	3.05e-89	766	1046	1	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CEF78036.1|GH2	0.0	1	1049	1	1049
CZS81335.1|GH2	0.0	1	1049	1	1049
QPC70706.1|GH2	0.0	1	1049	1	1049
QPC59330.1|GH2	0.0	1	1049	1	1049
CEI61767.1|GH2	0.0	1	1049	1	1049

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3OB8_A	2.52e-251	7	1044	5	1027	Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_B Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_C Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OB8_D Structure of the beta-galactosidase from Kluyveromyces lactis in complex with galactose [Kluyveromyces lactis],3OBA_A Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_B Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_C Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis],3OBA_D Structure of the beta-galactosidase from Kluyveromyces lactis [Kluyveromyces lactis]
6S6Z_A	1.84e-190	39	1021	32	953	Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	1.89e-190	39	1021	33	954	Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6ETZ_A	2.17e-177	11	1042	1	981	Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB [Arthrobacter sp. 32cB],6H1P_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB - data collected at room temperature [Arthrobacter sp. 32cB]
6SEB_A	3.87e-177	11	1042	22	1002	Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB in complex with IPTG [Arthrobacter sp. 32cB],6SEC_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cBon complex with ONPG [Arthrobacter sp. 32cB],6SED_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB in complex with galactose [Arthrobacter sp. 32cB]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P00723|BGAL_KLULA	4.13e-250	14	1044	5	1020	Beta-galactosidase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=LAC4 PE=1 SV=2
sp|P06864|BGA2_ECOLI	2.21e-205	25	1049	6	1000	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
sp|Q56307|BGAL_THEMA	9.73e-190	39	1021	33	954	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
sp|B4S2K9|BGAL_ALTMD	2.28e-185	13	1021	3	1011	Beta-galactosidase OS=Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype) OX=1774373 GN=lacZ PE=3 SV=1
sp|Q6LL68|BGAL_PHOPR	8.38e-182	47	1048	48	1027	Beta-galactosidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000005

TMHMM  Annotations     

There is no transmembrane helices in FGRAMPH1_01T12467-p1.